BLASTX nr result
ID: Ophiopogon24_contig00038164
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00038164 (511 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG59467.1| hypothetical protein GLOIN_2v1487791 [Rhizophagus... 87 7e-17 gb|PKY59695.1| hypothetical protein RhiirA4_482665 [Rhizophagus ... 75 1e-12 >gb|POG59467.1| hypothetical protein GLOIN_2v1487791 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 421 Score = 87.0 bits (214), Expect = 7e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +3 Query: 57 EEKDSQEVQMLWKGVMSNTGEITFYYFMDNLKKYLEHNMETVLDED 194 EEKDSQEVQ LWKGVMSNTG ITFYYFMD+LKK LEHNMETVLDE+ Sbjct: 87 EEKDSQEVQTLWKGVMSNTGGITFYYFMDDLKKDLEHNMETVLDEE 132 >gb|PKY59695.1| hypothetical protein RhiirA4_482665 [Rhizophagus irregularis] Length = 434 Score = 75.1 bits (183), Expect = 1e-12 Identities = 39/62 (62%), Positives = 41/62 (66%) Frame = +3 Query: 105 SNTGEITFYYFMDNLKKYLEHNMETVLDEDXXXXXXXXXXXXXXXXXXKGPFKATILRNK 284 SNTG ITFYYFMD+LKK LEHNMETVLDED KGP K+TILRNK Sbjct: 116 SNTGGITFYYFMDDLKKDLEHNMETVLDEDSATTVTTQTSRSSRTSRSKGPSKSTILRNK 175 Query: 285 QK 290 QK Sbjct: 176 QK 177