BLASTX nr result
ID: Ophiopogon24_contig00037985
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00037985 (503 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254051.1| probable E3 ubiquitin-protein ligase ATL45 [... 57 3e-07 >ref|XP_020254051.1| probable E3 ubiquitin-protein ligase ATL45 [Asparagus officinalis] gb|ONK79656.1| uncharacterized protein A4U43_C01F8670 [Asparagus officinalis] Length = 140 Score = 57.0 bits (136), Expect = 3e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = +3 Query: 360 QAYHGVDEEVLSSIPVQAYSKDHKFLCSKYQNECSVCLSGLEEGEPVR 503 QA GVD+ +L+ +PVQ Y+K+ KFL S NECSVCLSG+EEG +R Sbjct: 48 QARAGVDQRILALLPVQTYNKNFKFLPSG-SNECSVCLSGIEEGMKIR 94