BLASTX nr result
ID: Ophiopogon24_contig00037609
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00037609 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271685.1| formin-2-like [Asparagus officinalis] 56 2e-06 >ref|XP_020271685.1| formin-2-like [Asparagus officinalis] Length = 283 Score = 56.2 bits (134), Expect = 2e-06 Identities = 36/89 (40%), Positives = 39/89 (43%), Gaps = 1/89 (1%) Frame = -3 Query: 456 PPVPELPPIVTWPPLIPGVPYAPTIPWHTXXXXXXXXXXXXXXXXXXXXXPFIPKVPGAG 277 P VP+LPPIVT PP IPG P APT P HT IP VP A Sbjct: 139 PSVPKLPPIVTRPPPIPGAPEAPTFPGHTIPPWSSPSVPKLPPTVTRPPP--IPGVPDAP 196 Query: 276 AYPGHTXXXXXXXXXXXXXPVIA-RPPLP 193 PGHT P+I RPP+P Sbjct: 197 VLPGHTIPPLSSPSVPKLPPIIGRRPPIP 225