BLASTX nr result
ID: Ophiopogon24_contig00037608
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00037608 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271685.1| formin-2-like [Asparagus officinalis] 57 1e-06 >ref|XP_020271685.1| formin-2-like [Asparagus officinalis] Length = 283 Score = 57.0 bits (136), Expect = 1e-06 Identities = 31/66 (46%), Positives = 32/66 (48%) Frame = +3 Query: 3 PPVPELPPIVTRPPLIPGVPYAPTIPGHTXXXXXXXXXXXXXXXXXXXXXXFTPKVPGAG 182 P VP+LPPIVTRPP IPG P APT PGHT P VP A Sbjct: 139 PSVPKLPPIVTRPPPIPGAPEAPTFPGHTIPPWSSPSVPKLPPTVTRPPP--IPGVPDAP 196 Query: 183 AYPGHT 200 PGHT Sbjct: 197 VLPGHT 202