BLASTX nr result
ID: Ophiopogon24_contig00037515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00037515 (510 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274424.1| putative protein TPRXL [Asparagus officinali... 57 2e-06 >ref|XP_020274424.1| putative protein TPRXL [Asparagus officinalis] gb|ONK63684.1| uncharacterized protein A4U43_C07F17820 [Asparagus officinalis] Length = 329 Score = 57.0 bits (136), Expect = 2e-06 Identities = 36/81 (44%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = +1 Query: 184 VDQIHGDPLRXXXXXXXXXXXXPRDSLLRPKLVXXXXXXXXXXXXXXXELYKMRVVYDLL 363 VDQIHGDPL PR S PK+V ++YKMRVVY +L Sbjct: 125 VDQIHGDPL-LALALAAASAANPRASF-SPKVVKKARSKIQKQKRKYKDIYKMRVVYSML 182 Query: 364 NSQRSKDQDE-DNAPAVFSLP 423 NSQ + D+D+ D APAVF+LP Sbjct: 183 NSQGNNDKDDNDEAPAVFALP 203