BLASTX nr result
ID: Ophiopogon24_contig00037490
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00037490 (586 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009406616.1| PREDICTED: cytoplasmic 60S subunit biogenesi... 74 4e-12 ref|XP_010914164.1| PREDICTED: cytoplasmic 60S subunit biogenesi... 73 1e-11 ref|XP_008794317.1| PREDICTED: cytoplasmic 60S subunit biogenesi... 73 1e-11 ref|XP_020264674.1| cytoplasmic 60S subunit biogenesis factor RE... 72 3e-11 ref|XP_008794318.1| PREDICTED: cytoplasmic 60S subunit biogenesi... 72 4e-11 ref|XP_015885346.1| PREDICTED: cytoplasmic 60S subunit biogenesi... 71 5e-11 ref|XP_022732596.1| cytoplasmic 60S subunit biogenesis factor RE... 70 2e-10 gb|PKA57584.1| hypothetical protein AXF42_Ash018559 [Apostasia s... 69 2e-10 gb|KJB55202.1| hypothetical protein B456_009G068400 [Gossypium r... 68 4e-10 ref|XP_019230364.1| PREDICTED: cytoplasmic 60S subunit biogenesi... 69 4e-10 gb|KJB55204.1| hypothetical protein B456_009G068400 [Gossypium r... 68 5e-10 gb|PPR98933.1| hypothetical protein GOBAR_AA21744 [Gossypium bar... 68 5e-10 ref|WP_080604446.1| C2H2-type zinc finger protein [Sinorhizobium... 63 5e-10 ref|XP_016726419.1| PREDICTED: cytoplasmic 60S subunit biogenesi... 68 6e-10 ref|XP_012443252.1| PREDICTED: zinc finger protein 622-like [Gos... 68 6e-10 ref|XP_017630734.1| PREDICTED: cytoplasmic 60S subunit biogenesi... 68 6e-10 ref|XP_002527963.1| PREDICTED: zinc finger protein 622 [Ricinus ... 68 6e-10 ref|XP_016689364.1| PREDICTED: cytoplasmic 60S subunit biogenesi... 68 6e-10 dbj|GAV77891.1| LOW QUALITY PROTEIN: zf-C2H2_2 domain-containing... 68 6e-10 gb|PPD75453.1| hypothetical protein GOBAR_DD27633 [Gossypium bar... 68 6e-10 >ref|XP_009406616.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 2-like [Musa acuminata subsp. malaccensis] Length = 417 Score = 74.3 bits (181), Expect = 4e-12 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP QSLEA RKHMIAKGHCKVRYG Sbjct: 240 FMCLYCNERCHPFQSLEAVRKHMIAKGHCKVRYG 273 >ref|XP_010914164.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 1 [Elaeis guineensis] Length = 418 Score = 73.2 bits (178), Expect = 1e-11 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP QSLEA RKHMIAKGHCK+RYG Sbjct: 241 FMCLYCNERCHPFQSLEAVRKHMIAKGHCKLRYG 274 >ref|XP_008794317.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 1-like [Phoenix dactylifera] ref|XP_008776891.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 1-like [Phoenix dactylifera] Length = 418 Score = 73.2 bits (178), Expect = 1e-11 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP QSLEA RKHMIAKGHCK+RYG Sbjct: 241 FMCLYCNERCHPFQSLEAVRKHMIAKGHCKLRYG 274 >ref|XP_020264674.1| cytoplasmic 60S subunit biogenesis factor REI1 homolog 1 [Asparagus officinalis] gb|ONK69590.1| uncharacterized protein A4U43_C05F24570 [Asparagus officinalis] Length = 411 Score = 72.0 bits (175), Expect = 3e-11 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP QSLEA RKHM+AKGHCK+R+G Sbjct: 234 FMCLYCNERCHPFQSLEAVRKHMVAKGHCKIRFG 267 >ref|XP_008794318.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 2-like [Phoenix dactylifera] ref|XP_008776890.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 2-like [Phoenix dactylifera] Length = 426 Score = 71.6 bits (174), Expect = 4e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 F+CLYCN RCHP QSLEA RKHMIAKGHCK+RYG Sbjct: 249 FVCLYCNERCHPFQSLEAVRKHMIAKGHCKLRYG 282 >ref|XP_015885346.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 1 [Ziziphus jujuba] Length = 412 Score = 71.2 bits (173), Expect = 5e-11 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCNYRCHP SLEA RKHM+AK HCKV YG Sbjct: 235 FMCLYCNYRCHPFSSLEAVRKHMVAKSHCKVHYG 268 >ref|XP_022732596.1| cytoplasmic 60S subunit biogenesis factor REI1 homolog 1-like [Durio zibethinus] Length = 409 Score = 69.7 bits (169), Expect = 2e-10 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEA RKHM+AKGHCKV YG Sbjct: 233 FMCLYCNERCHPFTSLEAVRKHMVAKGHCKVHYG 266 >gb|PKA57584.1| hypothetical protein AXF42_Ash018559 [Apostasia shenzhenica] Length = 418 Score = 69.3 bits (168), Expect = 2e-10 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 F CLYCN RCHP QSLEA RKHM+AKGHCK++YG Sbjct: 241 FTCLYCNERCHPFQSLEAVRKHMVAKGHCKLKYG 274 >gb|KJB55202.1| hypothetical protein B456_009G068400 [Gossypium raimondii] Length = 311 Score = 68.2 bits (165), Expect = 4e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEA RKHM AKGHCKV YG Sbjct: 231 FMCLYCNERCHPFASLEAVRKHMAAKGHCKVHYG 264 >ref|XP_019230364.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 1-like [Nicotiana attenuata] gb|OIT06451.1| cytoplasmic 60s subunit biogenesis factor rei1 -like 1 [Nicotiana attenuata] Length = 412 Score = 68.6 bits (166), Expect = 4e-10 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEAARKHM AK HCKVRYG Sbjct: 235 FMCLYCNDRCHPFSSLEAARKHMEAKSHCKVRYG 268 >gb|KJB55204.1| hypothetical protein B456_009G068400 [Gossypium raimondii] Length = 342 Score = 68.2 bits (165), Expect = 5e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEA RKHM AKGHCKV YG Sbjct: 166 FMCLYCNERCHPFASLEAVRKHMAAKGHCKVHYG 199 >gb|PPR98933.1| hypothetical protein GOBAR_AA21744 [Gossypium barbadense] Length = 383 Score = 68.2 bits (165), Expect = 5e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEA RKHM AKGHCKV YG Sbjct: 218 FMCLYCNERCHPFASLEAVRKHMAAKGHCKVHYG 251 >ref|WP_080604446.1| C2H2-type zinc finger protein [Sinorhizobium fredii] Length = 72 Score = 63.2 bits (152), Expect = 5e-10 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +2 Query: 5 MCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 MCLYCN RCHP SLEA RKHM AK HCKV YG Sbjct: 1 MCLYCNDRCHPFTSLEAVRKHMAAKSHCKVHYG 33 >ref|XP_016726419.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 1-like [Gossypium hirsutum] Length = 407 Score = 68.2 bits (165), Expect = 6e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEA RKHM AKGHCKV YG Sbjct: 231 FMCLYCNERCHPFASLEAVRKHMAAKGHCKVHYG 264 >ref|XP_012443252.1| PREDICTED: zinc finger protein 622-like [Gossypium raimondii] ref|XP_012443253.1| PREDICTED: zinc finger protein 622-like [Gossypium raimondii] gb|KJB55201.1| hypothetical protein B456_009G068400 [Gossypium raimondii] gb|KJB55205.1| hypothetical protein B456_009G068400 [Gossypium raimondii] Length = 407 Score = 68.2 bits (165), Expect = 6e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEA RKHM AKGHCKV YG Sbjct: 231 FMCLYCNERCHPFASLEAVRKHMAAKGHCKVHYG 264 >ref|XP_017630734.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 1-like [Gossypium arboreum] gb|KHG19598.1| Zinc finger protein [Gossypium arboreum] Length = 407 Score = 68.2 bits (165), Expect = 6e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEA RKHM AKGHCKV YG Sbjct: 231 FMCLYCNERCHPFASLEAVRKHMAAKGHCKVHYG 264 >ref|XP_002527963.1| PREDICTED: zinc finger protein 622 [Ricinus communis] gb|EEF34375.1| transcription factor, putative [Ricinus communis] Length = 407 Score = 68.2 bits (165), Expect = 6e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEA RKHM AKGHCKV YG Sbjct: 231 FMCLYCNDRCHPFNSLEAVRKHMAAKGHCKVHYG 264 >ref|XP_016689364.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 1-like [Gossypium hirsutum] ref|XP_016689365.1| PREDICTED: cytoplasmic 60S subunit biogenesis factor REI1 homolog 1-like [Gossypium hirsutum] Length = 409 Score = 68.2 bits (165), Expect = 6e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEA RKHM AKGHCKV YG Sbjct: 233 FMCLYCNERCHPFASLEAVRKHMAAKGHCKVHYG 266 >dbj|GAV77891.1| LOW QUALITY PROTEIN: zf-C2H2_2 domain-containing protein/zf-met domain-containing protein [Cephalotus follicularis] Length = 411 Score = 68.2 bits (165), Expect = 6e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEA RKHM AKGHCKV YG Sbjct: 238 FMCLYCNDRCHPFNSLEAVRKHMAAKGHCKVHYG 271 >gb|PPD75453.1| hypothetical protein GOBAR_DD27633 [Gossypium barbadense] Length = 449 Score = 68.2 bits (165), Expect = 6e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +2 Query: 2 FMCLYCNYRCHPLQSLEAARKHMIAKGHCKVRYG 103 FMCLYCN RCHP SLEA RKHM AKGHCKV YG Sbjct: 273 FMCLYCNERCHPFASLEAVRKHMAAKGHCKVHYG 306