BLASTX nr result
ID: Ophiopogon24_contig00037461
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00037461 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242889.1| uncharacterized protein LOC109821106 [Aspara... 55 3e-06 ref|XP_020272203.1| uncharacterized protein LOC109847383 [Aspara... 55 4e-06 ref|XP_020262567.1| uncharacterized protein LOC109838548 [Aspara... 56 4e-06 ref|XP_020271748.1| uncharacterized protein LOC109846922 [Aspara... 55 6e-06 >ref|XP_020242889.1| uncharacterized protein LOC109821106 [Asparagus officinalis] Length = 186 Score = 55.5 bits (132), Expect = 3e-06 Identities = 22/50 (44%), Positives = 34/50 (68%) Frame = +1 Query: 4 DTAMFVFVWIIWKERNERIFNNSCKSSICLLNSIICFADFWIGSMSLSVK 153 D + VW +W+ERN+R+F+N K S+ LLN I+ F+ FW+GS +S + Sbjct: 100 DVFICSLVWCVWQERNDRLFSNKRKRSLELLNKIMTFSSFWLGSKKISAR 149 >ref|XP_020272203.1| uncharacterized protein LOC109847383 [Asparagus officinalis] Length = 207 Score = 55.5 bits (132), Expect = 4e-06 Identities = 19/43 (44%), Positives = 32/43 (74%) Frame = +1 Query: 25 VWIIWKERNERIFNNSCKSSICLLNSIICFADFWIGSMSLSVK 153 +W +W+ERN+R+F+N K S+ LLN I+ ++ FW+GS +S + Sbjct: 130 IWCVWQERNDRLFSNKQKGSLLLLNKIVTYSTFWLGSKEISAR 172 >ref|XP_020262567.1| uncharacterized protein LOC109838548 [Asparagus officinalis] Length = 311 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/43 (48%), Positives = 33/43 (76%) Frame = +1 Query: 25 VWIIWKERNERIFNNSCKSSICLLNSIICFADFWIGSMSLSVK 153 +W +W+ERN+RIF++ KSS+ LLN I+ F+ FW+GS +S + Sbjct: 237 IWCLWQERNDRIFSDKKKSSLTLLNKIVTFSTFWLGSEGISAR 279 >ref|XP_020271748.1| uncharacterized protein LOC109846922 [Asparagus officinalis] Length = 231 Score = 55.1 bits (131), Expect = 6e-06 Identities = 19/43 (44%), Positives = 32/43 (74%) Frame = +1 Query: 25 VWIIWKERNERIFNNSCKSSICLLNSIICFADFWIGSMSLSVK 153 +W +W+ERN+R+F+N K S+ LLN I+ ++ FW+GS +S + Sbjct: 154 IWSVWQERNDRLFSNKQKGSLLLLNKIVTYSTFWLGSKGISAR 196