BLASTX nr result
ID: Ophiopogon24_contig00037342
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00037342 (619 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010931183.1| PREDICTED: uncharacterized protein LOC105052... 70 1e-11 >ref|XP_010931183.1| PREDICTED: uncharacterized protein LOC105052164 [Elaeis guineensis] Length = 161 Score = 70.5 bits (171), Expect = 1e-11 Identities = 35/81 (43%), Positives = 46/81 (56%), Gaps = 2/81 (2%) Frame = -2 Query: 537 WGRHNFMLAEKSENRKLIPSSMELGLMGIKRQLQQVSVPDDKE-NDDAVEPAGPSYP-GT 364 W +H +L + LIP +L ++RQ+Q+ P+ ND V+PAGP Y G Sbjct: 81 WSQHGLLLDGLEGHDNLIPPE-KLIKAHVRRQIQEADSPESSSSNDKMVQPAGPGYQLGA 139 Query: 363 GTQGHHTIDLETWEKQHPKPP 301 T HHTIDL+TW QHPKPP Sbjct: 140 STDSHHTIDLQTWNNQHPKPP 160