BLASTX nr result
ID: Ophiopogon24_contig00037314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00037314 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59643.1| uncharacterized protein A4U43_C08F8730 [Asparagus... 56 3e-06 ref|XP_020242718.1| MATH domain-containing protein At5g43560-lik... 56 3e-06 >gb|ONK59643.1| uncharacterized protein A4U43_C08F8730 [Asparagus officinalis] Length = 656 Score = 55.8 bits (133), Expect = 3e-06 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 4/72 (5%) Frame = -1 Query: 430 ARQRRNNL*E**RKR*E-IFGNDEEKHALQDCLSGDRILENF-SEHGLRAIGKSDLTR-- 263 ARQRRNN R + E GN++EKH D L G+RILE+F SEHG R KS+L Sbjct: 96 ARQRRNNSKGKGRGKVEKAVGNEKEKHKPHDSLFGERILEDFSSEHGHRDKEKSELREEV 155 Query: 262 VDVSDPGNDGAE 227 DVSDPG++G E Sbjct: 156 SDVSDPGDEGVE 167 >ref|XP_020242718.1| MATH domain-containing protein At5g43560-like [Asparagus officinalis] Length = 674 Score = 55.8 bits (133), Expect = 3e-06 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 4/72 (5%) Frame = -1 Query: 430 ARQRRNNL*E**RKR*E-IFGNDEEKHALQDCLSGDRILENF-SEHGLRAIGKSDLTR-- 263 ARQRRNN R + E GN++EKH D L G+RILE+F SEHG R KS+L Sbjct: 114 ARQRRNNSKGKGRGKVEKAVGNEKEKHKPHDSLFGERILEDFSSEHGHRDKEKSELREEV 173 Query: 262 VDVSDPGNDGAE 227 DVSDPG++G E Sbjct: 174 SDVSDPGDEGVE 185