BLASTX nr result
ID: Ophiopogon24_contig00037062
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00037062 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272475.1| anthranilate phosphoribosyltransferase, chlo... 62 2e-08 >ref|XP_020272475.1| anthranilate phosphoribosyltransferase, chloroplastic-like [Asparagus officinalis] gb|ONK79170.1| uncharacterized protein A4U43_C01F3640 [Asparagus officinalis] Length = 408 Score = 62.0 bits (149), Expect = 2e-08 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = +1 Query: 253 MAAFRCLSIV-SSLIACNHLDWEKKPLN-CLLPPIRRSMKNNRRKLVTSPSSALRGLGGS 426 M+AF CLS V S AC +L+ KKP+N LL IR K N+RKL+ SPSSA+RGLGGS Sbjct: 1 MSAFSCLSTVYPSSSACKYLNRAKKPMNHSLLAQIRGEEKKNKRKLIISPSSAVRGLGGS 60 Query: 427 S 429 S Sbjct: 61 S 61