BLASTX nr result
ID: Ophiopogon24_contig00036929
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00036929 (661 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK75520.1| uncharacterized protein A4U43_C03F17750 [Asparagu... 80 1e-13 >gb|ONK75520.1| uncharacterized protein A4U43_C03F17750 [Asparagus officinalis] Length = 638 Score = 79.7 bits (195), Expect = 1e-13 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 7/104 (6%) Frame = +1 Query: 10 LLLLLIVVPTEGSVAECSDGSVMFRFADAEDSKKQGESLLDFREEDKGNRAKMVGAVESF 189 LLLLL+VV TEG VAECSDGSV+FRFADAED K+ E L + R+ + G R Sbjct: 13 LLLLLLVVLTEGLVAECSDGSVIFRFADAEDPKRVKE-LRESRDGEFGER---------M 62 Query: 190 DLAGESEVIEQDFGIEGEKLE-------SDAVSEKSVGMESEKL 300 + AG SEV++++FG+E + SDAVSEK +G+ K+ Sbjct: 63 EGAGGSEVLDREFGVESRDSDVEMGASGSDAVSEKEMGLVGSKM 106