BLASTX nr result
ID: Ophiopogon24_contig00036901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00036901 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17443.3| unnamed protein product, partial [Vitis vinifera] 54 6e-06 gb|PIA55872.1| hypothetical protein AQUCO_00700296v1 [Aquilegia ... 54 9e-06 ref|XP_002275309.1| PREDICTED: peroxidase 72 [Vitis vinifera] 54 9e-06 >emb|CBI17443.3| unnamed protein product, partial [Vitis vinifera] Length = 235 Score = 53.5 bits (127), Expect = 6e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = -1 Query: 139 CYGHAYGGGYLYPQFYDHSCPQALQIVKTI 50 C H GGYLYPQFYDHSCP+A QIVK++ Sbjct: 20 CLSHKTNGGYLYPQFYDHSCPKAQQIVKSV 49 >gb|PIA55872.1| hypothetical protein AQUCO_00700296v1 [Aquilegia coerulea] Length = 332 Score = 53.5 bits (127), Expect = 9e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = -1 Query: 139 CYGHAYGGGYLYPQFYDHSCPQALQIVKTI 50 C H GGYLYPQ+YDHSCP+AL+IVK++ Sbjct: 20 CLSHKSNGGYLYPQYYDHSCPKALEIVKSV 49 >ref|XP_002275309.1| PREDICTED: peroxidase 72 [Vitis vinifera] Length = 332 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = -1 Query: 139 CYGHAYGGGYLYPQFYDHSCPQALQIVKTI 50 C H GGYLYPQFYDHSCP+A QIVK++ Sbjct: 20 CLSHKTNGGYLYPQFYDHSCPKAQQIVKSV 49