BLASTX nr result
ID: Ophiopogon24_contig00036847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00036847 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276877.1| uncharacterized protein LOC109851247 [Aspara... 59 7e-07 >ref|XP_020276877.1| uncharacterized protein LOC109851247 [Asparagus officinalis] Length = 647 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/68 (42%), Positives = 41/68 (60%), Gaps = 5/68 (7%) Frame = +1 Query: 1 VGFVLCPYAQNTFMRWVFKYTLDLTIIASYNWPQSVFDLRGK-----NL*CPERLVGKRV 165 +GFVLCP N+ WVF+Y +L + SYNW +V+DL K L +R VG+R Sbjct: 197 IGFVLCPQPSNSCPLWVFRYANNLLALRSYNWAGAVYDLLHKEMTRAKLSITKRAVGERS 256 Query: 166 KSGYIEGF 189 ++GY+ GF Sbjct: 257 RAGYMGGF 264