BLASTX nr result
ID: Ophiopogon24_contig00036799
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00036799 (505 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264055.1| ribonuclease 3-like protein 2, partial [Aspa... 63 2e-08 >ref|XP_020264055.1| ribonuclease 3-like protein 2, partial [Asparagus officinalis] Length = 333 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -2 Query: 267 ERGSAHGKKFLCYIRVVILNKEYINVGDLKARVKDAENTTAAKMLSEI 124 E G H KKF C ++V I NKEY VGDLK+R++D+EN+ AAK+L+EI Sbjct: 283 EEGPPHDKKFACSVQVRISNKEYFEVGDLKSRIRDSENSAAAKVLAEI 330