BLASTX nr result
ID: Ophiopogon24_contig00036601
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00036601 (466 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250826.1| DUF724 domain-containing protein 3-like isof... 77 1e-13 ref|XP_020250825.1| DUF724 domain-containing protein 3-like isof... 77 1e-13 gb|ONK54801.1| uncharacterized protein A4U43_UnF11180 [Asparagus... 77 1e-13 ref|XP_010914642.1| PREDICTED: DUF724 domain-containing protein ... 64 5e-09 ref|XP_010914641.1| PREDICTED: uncharacterized protein LOC105039... 64 5e-09 ref|XP_020260478.1| DUF724 domain-containing protein 3-like isof... 60 2e-07 ref|XP_020260477.1| DUF724 domain-containing protein 3-like isof... 60 2e-07 ref|XP_004288549.1| PREDICTED: uncharacterized protein LOC101309... 59 5e-07 ref|XP_011468885.1| PREDICTED: uncharacterized protein LOC101309... 59 5e-07 ref|XP_019705782.1| PREDICTED: DUF724 domain-containing protein ... 59 5e-07 ref|XP_010918489.1| PREDICTED: uncharacterized protein LOC105042... 59 5e-07 ref|XP_019705781.1| PREDICTED: DUF724 domain-containing protein ... 59 5e-07 ref|XP_010918488.1| PREDICTED: DUF724 domain-containing protein ... 59 5e-07 ref|XP_010918487.1| PREDICTED: DUF724 domain-containing protein ... 59 5e-07 ref|XP_017700356.1| PREDICTED: uncharacterized protein LOC103715... 58 7e-07 ref|XP_008801740.2| PREDICTED: DUF724 domain-containing protein ... 58 7e-07 ref|XP_020084822.1| DUF724 domain-containing protein 1 isoform X... 58 7e-07 ref|XP_020084820.1| DUF724 domain-containing protein 1 isoform X... 58 7e-07 gb|OAY82581.1| hypothetical protein ACMD2_11533 [Ananas comosus] 58 7e-07 ref|XP_020254958.1| DUF724 domain-containing protein 1-like [Asp... 58 9e-07 >ref|XP_020250826.1| DUF724 domain-containing protein 3-like isoform X2 [Asparagus officinalis] Length = 977 Score = 77.4 bits (189), Expect = 1e-13 Identities = 40/81 (49%), Positives = 54/81 (66%), Gaps = 1/81 (1%) Frame = -3 Query: 458 IAPG-DKLASIGLQSDQDMSKDGEMALLGPSLVELPSENSVLPFTQRSEFWDLFETEEVF 282 IAP D+LAS+GL S +D++KDGE+A SE S LPFT+RS+ W++ E+ E+F Sbjct: 753 IAPEHDELASVGLSSAEDITKDGEIA----------SERSPLPFTKRSQLWEVVESREIF 802 Query: 281 RLLPQQPHFRPLL*YRKEFRE 219 PQ PHF+ LL Y K+ RE Sbjct: 803 NTFPQHPHFQSLLQYEKDLRE 823 >ref|XP_020250825.1| DUF724 domain-containing protein 3-like isoform X1 [Asparagus officinalis] Length = 980 Score = 77.4 bits (189), Expect = 1e-13 Identities = 40/81 (49%), Positives = 54/81 (66%), Gaps = 1/81 (1%) Frame = -3 Query: 458 IAPG-DKLASIGLQSDQDMSKDGEMALLGPSLVELPSENSVLPFTQRSEFWDLFETEEVF 282 IAP D+LAS+GL S +D++KDGE+A SE S LPFT+RS+ W++ E+ E+F Sbjct: 756 IAPEHDELASVGLSSAEDITKDGEIA----------SERSPLPFTKRSQLWEVVESREIF 805 Query: 281 RLLPQQPHFRPLL*YRKEFRE 219 PQ PHF+ LL Y K+ RE Sbjct: 806 NTFPQHPHFQSLLQYEKDLRE 826 >gb|ONK54801.1| uncharacterized protein A4U43_UnF11180 [Asparagus officinalis] Length = 1092 Score = 77.4 bits (189), Expect = 1e-13 Identities = 40/81 (49%), Positives = 54/81 (66%), Gaps = 1/81 (1%) Frame = -3 Query: 458 IAPG-DKLASIGLQSDQDMSKDGEMALLGPSLVELPSENSVLPFTQRSEFWDLFETEEVF 282 IAP D+LAS+GL S +D++KDGE+A SE S LPFT+RS+ W++ E+ E+F Sbjct: 868 IAPEHDELASVGLSSAEDITKDGEIA----------SERSPLPFTKRSQLWEVVESREIF 917 Query: 281 RLLPQQPHFRPLL*YRKEFRE 219 PQ PHF+ LL Y K+ RE Sbjct: 918 NTFPQHPHFQSLLQYEKDLRE 938 >ref|XP_010914642.1| PREDICTED: DUF724 domain-containing protein 6 isoform X2 [Elaeis guineensis] Length = 901 Score = 64.3 bits (155), Expect = 5e-09 Identities = 34/77 (44%), Positives = 45/77 (58%) Frame = -3 Query: 449 GDKLASIGLQSDQDMSKDGEMALLGPSLVELPSENSVLPFTQRSEFWDLFETEEVFRLLP 270 GD +G Q DQ + G++ + E P + S LPF +RS W+ FE+ E+ +P Sbjct: 671 GDLAPPLGGQIDQ-RAPTGKVKAVTEPRCESPPKKSYLPFEKRSSLWESFESMEILSAMP 729 Query: 269 QQPHFRPLL*YRKEFRE 219 QQPHFRPL Y KEFRE Sbjct: 730 QQPHFRPLGQYCKEFRE 746 >ref|XP_010914641.1| PREDICTED: uncharacterized protein LOC105039982 isoform X1 [Elaeis guineensis] Length = 936 Score = 64.3 bits (155), Expect = 5e-09 Identities = 34/77 (44%), Positives = 45/77 (58%) Frame = -3 Query: 449 GDKLASIGLQSDQDMSKDGEMALLGPSLVELPSENSVLPFTQRSEFWDLFETEEVFRLLP 270 GD +G Q DQ + G++ + E P + S LPF +RS W+ FE+ E+ +P Sbjct: 706 GDLAPPLGGQIDQ-RAPTGKVKAVTEPRCESPPKKSYLPFEKRSSLWESFESMEILSAMP 764 Query: 269 QQPHFRPLL*YRKEFRE 219 QQPHFRPL Y KEFRE Sbjct: 765 QQPHFRPLGQYCKEFRE 781 >ref|XP_020260478.1| DUF724 domain-containing protein 3-like isoform X2 [Asparagus officinalis] Length = 818 Score = 59.7 bits (143), Expect = 2e-07 Identities = 34/76 (44%), Positives = 47/76 (61%), Gaps = 1/76 (1%) Frame = -3 Query: 443 KLASIGLQSDQDMSKDGEMALLGPSLVELPSENSVLPFTQRS-EFWDLFETEEVFRLLPQ 267 ++ S S +D+ D L+ S +E S SVLPF + S E W+L E+ EVFR+LPQ Sbjct: 594 RIESSKRSSGKDIVMDCGTPLIDSSHMESSSVRSVLPFIKTSSEVWNLVESREVFRMLPQ 653 Query: 266 QPHFRPLL*YRKEFRE 219 +PHF+PLL + K RE Sbjct: 654 RPHFQPLLHHAKLHRE 669 >ref|XP_020260477.1| DUF724 domain-containing protein 3-like isoform X1 [Asparagus officinalis] gb|ONK71385.1| uncharacterized protein A4U43_C04F8000 [Asparagus officinalis] Length = 938 Score = 59.7 bits (143), Expect = 2e-07 Identities = 34/76 (44%), Positives = 47/76 (61%), Gaps = 1/76 (1%) Frame = -3 Query: 443 KLASIGLQSDQDMSKDGEMALLGPSLVELPSENSVLPFTQRS-EFWDLFETEEVFRLLPQ 267 ++ S S +D+ D L+ S +E S SVLPF + S E W+L E+ EVFR+LPQ Sbjct: 714 RIESSKRSSGKDIVMDCGTPLIDSSHMESSSVRSVLPFIKTSSEVWNLVESREVFRMLPQ 773 Query: 266 QPHFRPLL*YRKEFRE 219 +PHF+PLL + K RE Sbjct: 774 RPHFQPLLHHAKLHRE 789 >ref|XP_004288549.1| PREDICTED: uncharacterized protein LOC101309389 isoform X2 [Fragaria vesca subsp. vesca] Length = 770 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = -3 Query: 356 PSENSVLPFTQRSEFWDLFETEEVFRLLPQQPHFRPLL*YRKEFREVF 213 P EN ++PF + S W E+ +VFR++PQ PHFRPL+ ++E+RE F Sbjct: 576 PDENQIMPFVKSSPIWKAIESFDVFRIMPQNPHFRPLVKCKEEYREGF 623 >ref|XP_011468885.1| PREDICTED: uncharacterized protein LOC101309389 isoform X1 [Fragaria vesca subsp. vesca] Length = 795 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = -3 Query: 356 PSENSVLPFTQRSEFWDLFETEEVFRLLPQQPHFRPLL*YRKEFREVF 213 P EN ++PF + S W E+ +VFR++PQ PHFRPL+ ++E+RE F Sbjct: 601 PDENQIMPFVKSSPIWKAIESFDVFRIMPQNPHFRPLVKCKEEYREGF 648 >ref|XP_019705782.1| PREDICTED: DUF724 domain-containing protein 3-like isoform X3 [Elaeis guineensis] Length = 910 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/62 (43%), Positives = 36/62 (58%) Frame = -3 Query: 404 SKDGEMALLGPSLVELPSENSVLPFTQRSEFWDLFETEEVFRLLPQQPHFRPLL*YRKEF 225 S + AL PS S+ +LPF + S W+ E ++F ++PQQPHFRPL Y EF Sbjct: 694 SDENREALFDPSSSRSSSKEVILPFVKSSFMWESIEAMDIFHIMPQQPHFRPLEQYSMEF 753 Query: 224 RE 219 RE Sbjct: 754 RE 755 >ref|XP_010918489.1| PREDICTED: uncharacterized protein LOC105042847 isoform X2 [Elaeis guineensis] Length = 914 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/85 (37%), Positives = 46/85 (54%), Gaps = 5/85 (5%) Frame = -3 Query: 458 IAPGDKLASI-GLQSDQDMSK----DGEMALLGPSLVELPSENSVLPFTQRSEFWDLFET 294 ++ D AS GL + SK + + AL+ PS + +LPF + S W+ E Sbjct: 675 VSKKDNAASYKGLNPSESPSKRTSDENKEALIDPSSSHSSLKEVILPFLKSSSMWESIEA 734 Query: 293 EEVFRLLPQQPHFRPLL*YRKEFRE 219 ++F ++PQQPHFRPL Y EFRE Sbjct: 735 MDIFHIIPQQPHFRPLEQYSMEFRE 759 >ref|XP_019705781.1| PREDICTED: DUF724 domain-containing protein 2-like isoform X2 [Elaeis guineensis] Length = 941 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/62 (43%), Positives = 36/62 (58%) Frame = -3 Query: 404 SKDGEMALLGPSLVELPSENSVLPFTQRSEFWDLFETEEVFRLLPQQPHFRPLL*YRKEF 225 S + AL PS S+ +LPF + S W+ E ++F ++PQQPHFRPL Y EF Sbjct: 725 SDENREALFDPSSSRSSSKEVILPFVKSSFMWESIEAMDIFHIMPQQPHFRPLEQYSMEF 784 Query: 224 RE 219 RE Sbjct: 785 RE 786 >ref|XP_010918488.1| PREDICTED: DUF724 domain-containing protein 3-like isoform X1 [Elaeis guineensis] Length = 942 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/85 (37%), Positives = 46/85 (54%), Gaps = 5/85 (5%) Frame = -3 Query: 458 IAPGDKLASI-GLQSDQDMSK----DGEMALLGPSLVELPSENSVLPFTQRSEFWDLFET 294 ++ D AS GL + SK + + AL+ PS + +LPF + S W+ E Sbjct: 703 VSKKDNAASYKGLNPSESPSKRTSDENKEALIDPSSSHSSLKEVILPFLKSSSMWESIEA 762 Query: 293 EEVFRLLPQQPHFRPLL*YRKEFRE 219 ++F ++PQQPHFRPL Y EFRE Sbjct: 763 MDIFHIIPQQPHFRPLEQYSMEFRE 787 >ref|XP_010918487.1| PREDICTED: DUF724 domain-containing protein 2-like isoform X1 [Elaeis guineensis] Length = 942 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/62 (43%), Positives = 36/62 (58%) Frame = -3 Query: 404 SKDGEMALLGPSLVELPSENSVLPFTQRSEFWDLFETEEVFRLLPQQPHFRPLL*YRKEF 225 S + AL PS S+ +LPF + S W+ E ++F ++PQQPHFRPL Y EF Sbjct: 726 SDENREALFDPSSSRSSSKEVILPFVKSSFMWESIEAMDIFHIMPQQPHFRPLEQYSMEF 785 Query: 224 RE 219 RE Sbjct: 786 RE 787 >ref|XP_017700356.1| PREDICTED: uncharacterized protein LOC103715770 isoform X2 [Phoenix dactylifera] Length = 670 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = -3 Query: 356 PSENSVLPFTQRSEFWDLFETEEVFRLLPQQPHFRPLL*YRKEFRE 219 P++ S LPF + S W+ FE+ E+ +PQQPHFRPL Y KEFRE Sbjct: 470 PTKKSYLPFEKHSSLWESFESMEILSAMPQQPHFRPLEQYCKEFRE 515 >ref|XP_008801740.2| PREDICTED: DUF724 domain-containing protein 1-like isoform X1 [Phoenix dactylifera] Length = 817 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = -3 Query: 356 PSENSVLPFTQRSEFWDLFETEEVFRLLPQQPHFRPLL*YRKEFRE 219 P++ S LPF + S W+ FE+ E+ +PQQPHFRPL Y KEFRE Sbjct: 617 PTKKSYLPFEKHSSLWESFESMEILSAMPQQPHFRPLEQYCKEFRE 662 >ref|XP_020084822.1| DUF724 domain-containing protein 1 isoform X2 [Ananas comosus] Length = 922 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = -3 Query: 371 SLVELPSENSVLPFTQRSEFWDLFETEEVFRLLPQQPHFRPLL*YRKEFRE 219 S E P EN ++PF + S W+ ET EVF+ +PQQPHF PL Y EFRE Sbjct: 717 STCETPPENILVPFVKSSSIWESVETLEVFQRMPQQPHFLPLDQYSSEFRE 767 >ref|XP_020084820.1| DUF724 domain-containing protein 1 isoform X1 [Ananas comosus] Length = 929 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = -3 Query: 371 SLVELPSENSVLPFTQRSEFWDLFETEEVFRLLPQQPHFRPLL*YRKEFRE 219 S E P EN ++PF + S W+ ET EVF+ +PQQPHF PL Y EFRE Sbjct: 724 STCETPPENILVPFVKSSSIWESVETLEVFQRMPQQPHFLPLDQYSSEFRE 774 >gb|OAY82581.1| hypothetical protein ACMD2_11533 [Ananas comosus] Length = 929 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = -3 Query: 371 SLVELPSENSVLPFTQRSEFWDLFETEEVFRLLPQQPHFRPLL*YRKEFRE 219 S E P EN ++PF + S W+ ET EVF+ +PQQPHF PL Y EFRE Sbjct: 724 STCETPPENILVPFVKSSSIWESVETLEVFQRMPQQPHFLPLDQYSSEFRE 774 >ref|XP_020254958.1| DUF724 domain-containing protein 1-like [Asparagus officinalis] Length = 549 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = -3 Query: 365 VELPSENSVLPFTQRSEFWDLFETEEVFRLLPQQPHFRPLL*YRKEFRE 219 V+ P E LPF + S WD E+ EVF L+PQ PHFRPL Y+K+FRE Sbjct: 346 VKPPEERPSLPFEKCSFMWDSIESMEVFSLMPQHPHFRPLEEYQKDFRE 394