BLASTX nr result
ID: Ophiopogon24_contig00036536
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00036536 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020258429.1| uncharacterized protein LOC109834825 [Aspara... 67 7e-12 gb|ONK75015.1| uncharacterized protein A4U43_C03F12420 [Asparagu... 67 6e-11 >ref|XP_020258429.1| uncharacterized protein LOC109834825 [Asparagus officinalis] Length = 106 Score = 67.0 bits (162), Expect = 7e-12 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -3 Query: 378 LLKQVDGKDLTIQEVLADLMSC-EDPGRHWKPALQSIPEAAE 256 LLK++DG+DLT+QEVLA+LMS EDP RHWKPALQSIPE +E Sbjct: 65 LLKRIDGRDLTVQEVLANLMSHHEDPDRHWKPALQSIPEVSE 106 >gb|ONK75015.1| uncharacterized protein A4U43_C03F12420 [Asparagus officinalis] Length = 213 Score = 67.0 bits (162), Expect = 6e-11 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = -3 Query: 378 LLKQVDGKDLTIQEVLADLMSC-EDPGRHWKPALQSIPEAAE 256 LLK++DG+DLT+QEVLA+LMS EDP RHWKPALQSIPE +E Sbjct: 172 LLKRIDGRDLTVQEVLANLMSHHEDPDRHWKPALQSIPEVSE 213