BLASTX nr result
ID: Ophiopogon24_contig00036190
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00036190 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60641.1| uncharacterized protein A4U43_C08F20900 [Asparagu... 63 6e-09 >gb|ONK60641.1| uncharacterized protein A4U43_C08F20900 [Asparagus officinalis] Length = 412 Score = 62.8 bits (151), Expect = 6e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 134 CVRFIEAVPWTDDEEDRVLQILPFLSPDESCD 39 CVRFIEAVPWTDDEE+++LQILPFL PDES D Sbjct: 175 CVRFIEAVPWTDDEEEQILQILPFLKPDESRD 206