BLASTX nr result
ID: Ophiopogon24_contig00036125
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00036125 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK78017.1| uncharacterized protein A4U43_C02F13330 [Asparagu... 60 1e-07 ref|XP_020253669.1| LOW QUALITY PROTEIN: mediator of RNA polymer... 60 1e-07 >gb|ONK78017.1| uncharacterized protein A4U43_C02F13330 [Asparagus officinalis] Length = 1296 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -1 Query: 133 SHWEIFSQCLQLLVENSSALQNSTISSEALVQLVSDNCSGFCRE 2 S W +FSQCL LLVENS AL+NSTI E +QLVSD FCRE Sbjct: 216 SQWRLFSQCLYLLVENSLALRNSTIPLEGFLQLVSDKYGVFCRE 259 >ref|XP_020253669.1| LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 33A-like [Asparagus officinalis] Length = 1323 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -1 Query: 133 SHWEIFSQCLQLLVENSSALQNSTISSEALVQLVSDNCSGFCRE 2 S W +FSQCL LLVENS AL+NSTI E +QLVSD FCRE Sbjct: 243 SQWRLFSQCLYLLVENSLALRNSTIPLEGFLQLVSDKYGVFCRE 286