BLASTX nr result
ID: Ophiopogon24_contig00036074
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00036074 (624 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71472.1| hypothetical protein VITISV_040055 [Vitis vinifera] 44 3e-06 >emb|CAN71472.1| hypothetical protein VITISV_040055 [Vitis vinifera] Length = 374 Score = 44.3 bits (103), Expect(2) = 3e-06 Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 3/67 (4%) Frame = -2 Query: 362 RFGKKRKL---FVGLFEILRRVEKVAHRGSTSRICNYSYCF*HFEVEKLDPNHVIDHMPP 192 RFG+K KL FVG FEIL RV VA++ + + CF DP+HV++ P Sbjct: 254 RFGRKGKLSPHFVGPFEILERVGTVAYKVALPPSLSKEICF--------DPSHVVELEPI 305 Query: 191 QVQDELT 171 Q+ ++LT Sbjct: 306 QISEDLT 312 Score = 35.0 bits (79), Expect(2) = 3e-06 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -3 Query: 445 DYNDCRRRKREFKV-DHVFLKVSPIKG*RDLGR 350 D D RRR EF+V DHVFLKVSP+K GR Sbjct: 225 DNADNRRRDLEFEVGDHVFLKVSPMKSMMRFGR 257