BLASTX nr result
ID: Ophiopogon24_contig00035715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00035715 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_031709123.1| hypothetical protein [Mycobacterium tubercul... 93 2e-22 >ref|WP_031709123.1| hypothetical protein [Mycobacterium tuberculosis] Length = 60 Score = 93.2 bits (230), Expect = 2e-22 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 351 VNYRTRKEDCFSEESYGKSVPIDSINKQLSDFGVVEEIEKDRVDEPG 211 +NYRTRKEDCFSEESYGKSVPIDSINKQLSDF VVEEIEK+RVDEPG Sbjct: 1 MNYRTRKEDCFSEESYGKSVPIDSINKQLSDFEVVEEIEKERVDEPG 47