BLASTX nr result
ID: Ophiopogon24_contig00035636
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00035636 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK71260.1| uncharacterized protein A4U43_C04F6610 [Asparagus... 54 8e-06 >gb|ONK71260.1| uncharacterized protein A4U43_C04F6610 [Asparagus officinalis] Length = 235 Score = 53.5 bits (127), Expect = 8e-06 Identities = 19/46 (41%), Positives = 31/46 (67%) Frame = -3 Query: 250 RRSPYSFGLPTKICTNCGAIMWSEEKYSPHRQTSRTYSICCKNGKI 113 +++P++ P+K+C+ C AI+W EEK ++ Y+ CCKNGKI Sbjct: 19 KKTPFALYPPSKVCSKCNAIIWKEEKVKGQKKLESYYTTCCKNGKI 64