BLASTX nr result
ID: Ophiopogon24_contig00035427
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00035427 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018487374.1| PREDICTED: uncharacterized protein LOC108857... 51 1e-05 >ref|XP_018487374.1| PREDICTED: uncharacterized protein LOC108857847 [Raphanus sativus] ref|XP_018487385.1| PREDICTED: uncharacterized protein LOC108857868 [Raphanus sativus] ref|XP_018487450.1| PREDICTED: uncharacterized protein LOC108857942 [Raphanus sativus] Length = 102 Score = 51.2 bits (121), Expect = 1e-05 Identities = 29/75 (38%), Positives = 37/75 (49%) Frame = +1 Query: 100 FARTPCLQARKLSAASFEPSLFLSVLPRGRVVPPSAPSNGIHDEVAVDGKSYADARATTK 279 F PC + + LFLSVLP+G V PPS PS+ H D + + Sbjct: 28 FVSQPCEARKVVVPYDASKGLFLSVLPKGNV-PPSGPSDKGHTSPPEDYSDQHMVQGNSP 86 Query: 280 SVGRMLGSVPSPGIG 324 + R LGSVPSPG+G Sbjct: 87 EIYRQLGSVPSPGVG 101