BLASTX nr result
ID: Ophiopogon24_contig00035134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00035134 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK67985.1| uncharacterized protein A4U43_C05F5960 [Asparagus... 56 2e-06 >gb|ONK67985.1| uncharacterized protein A4U43_C05F5960 [Asparagus officinalis] Length = 231 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 9/70 (12%) Frame = -1 Query: 368 LPDWWRLLHGRRLGFSVTKEFRQSWIAYVSWLLWIDCNLIIFHSDSKKGRC--HVCSS-- 201 + +WW +LHG +GF + K FRQ+W AY +WLL +D N +F++ + C+S Sbjct: 1 MAEWWNILHGVGIGFGLVKAFRQAWNAYTAWLLLLDRNNSVFNNQMRPNEAIFESCNSLV 60 Query: 200 -----SCPRE 186 SCP E Sbjct: 61 LEQFASCPIE 70