BLASTX nr result
ID: Ophiopogon24_contig00035020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00035020 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK64574.1| uncharacterized protein A4U43_C07F27510 [Asparagu... 54 9e-06 >gb|ONK64574.1| uncharacterized protein A4U43_C07F27510 [Asparagus officinalis] Length = 239 Score = 53.5 bits (127), Expect = 9e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -2 Query: 391 DMEVVEERGEFELGMSLRMKGGLPVRVRER 302 D+EVVEER EFELG++LRM+GGLPVR++ER Sbjct: 208 DVEVVEERAEFELGLTLRMRGGLPVRIKER 237