BLASTX nr result
ID: Ophiopogon24_contig00034975
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00034975 (496 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010477907.2| PREDICTED: tubulin beta-2 chain-like [Cameli... 51 1e-08 ref|XP_021287540.1| tubulin beta-7 chain [Herrania umbratica] 53 2e-08 gb|KHN23648.1| Tubulin beta-1 chain [Glycine soja] 51 3e-08 ref|XP_010087906.1| tubulin beta-2 chain [Morus notabilis] >gi|5... 53 4e-08 gb|ANC98505.1| beta-tubulin, partial [Paeonia suffruticosa] 53 4e-08 ref|XP_006350813.1| PREDICTED: tubulin beta-2 chain-like [Solanu... 53 4e-08 ref|XP_004241186.1| PREDICTED: tubulin beta chain [Solanum lycop... 53 4e-08 gb|AQK93773.1| beta tubulin2 [Zea mays] 51 4e-08 ref|NP_001169637.1| beta tubulin 4 [Zea mays] >gi|224030571|gb|A... 48 4e-08 gb|KMZ64223.1| Tubulin beta-1 chain [Zostera marina] 52 5e-08 ref|XP_016204804.1| tubulin beta chain [Arachis ipaensis] 52 5e-08 ref|XP_015969832.1| tubulin beta chain [Arachis duranensis] 52 5e-08 ref|XP_006410628.1| tubulin beta chain isoform X1 [Eutrema salsu... 51 5e-08 ref|XP_022874431.1| tubulin beta-1 chain-like [Olea europaea var... 52 5e-08 ref|XP_020275972.1| tubulin beta-8 chain-like [Asparagus officin... 52 5e-08 ref|XP_008811481.1| PREDICTED: tubulin beta-8 chain-like [Phoeni... 52 5e-08 ref|XP_022862927.1| tubulin beta-8 chain-like [Olea europaea var... 52 5e-08 ref|XP_022001497.1| tubulin beta chain-like [Helianthus annuus] ... 52 5e-08 ref|XP_019167995.1| PREDICTED: tubulin beta-2 chain [Ipomoea nil] 52 5e-08 ref|XP_010676480.1| PREDICTED: tubulin beta-1 chain [Beta vulgar... 52 5e-08 >ref|XP_010477907.2| PREDICTED: tubulin beta-2 chain-like [Camelina sativa] Length = 308 Score = 51.2 bits (121), Expect(2) = 1e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 R+NVYYNEAS RF+PRA LMDLEP T+DS+ Sbjct: 50 RINVYYNEASCGRFVPRAVLMDLEPGTMDSL 80 Score = 35.8 bits (81), Expect(2) = 1e-08 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AENYDCL G + Sbjct: 119 SVLDVVRKEAENYDCLQGFQV 139 >ref|XP_021287540.1| tubulin beta-7 chain [Herrania umbratica] Length = 444 Score = 53.1 bits (126), Expect(2) = 2e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 R+NVYYNEAS RR++PRA LMDLEP T+DS+ Sbjct: 46 RINVYYNEASGRRYVPRAVLMDLEPGTMDSL 76 Score = 32.7 bits (73), Expect(2) = 2e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQI 135 >gb|KHN23648.1| Tubulin beta-1 chain [Glycine soja] Length = 446 Score = 50.8 bits (120), Expect(2) = 3e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS R++PRA LMDLEP T+DS+ Sbjct: 46 RVNVYYNEASGGRYVPRAVLMDLEPGTMDSL 76 Score = 34.7 bits (78), Expect(2) = 3e-08 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNLY 172 SVLDVVRK+AEN DCL G+ ++ Sbjct: 115 SVLDVVRKEAENCDCLQGLQIF 136 >ref|XP_010087906.1| tubulin beta-2 chain [Morus notabilis] gb|EXB30492.1| Tubulin beta-1 chain [Morus notabilis] Length = 448 Score = 52.8 bits (125), Expect(2) = 4e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 R+NVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 46 RINVYYNEASTGRFVPRAVLMDLEPGTMDSI 76 Score = 32.3 bits (72), Expect(2) = 4e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135 >gb|ANC98505.1| beta-tubulin, partial [Paeonia suffruticosa] Length = 447 Score = 52.8 bits (125), Expect(2) = 4e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 46 RVNVYYNEASGGRFVPRAVLMDLEPGTMDSI 76 Score = 32.3 bits (72), Expect(2) = 4e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135 >ref|XP_006350813.1| PREDICTED: tubulin beta-2 chain-like [Solanum tuberosum] Length = 446 Score = 52.8 bits (125), Expect(2) = 4e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 46 RVNVYYNEASGGRFVPRAVLMDLEPGTMDSI 76 Score = 32.3 bits (72), Expect(2) = 4e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135 >ref|XP_004241186.1| PREDICTED: tubulin beta chain [Solanum lycopersicum] ref|XP_015079142.1| PREDICTED: tubulin beta chain-like [Solanum pennellii] Length = 446 Score = 52.8 bits (125), Expect(2) = 4e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 46 RVNVYYNEASGGRFVPRAVLMDLEPGTMDSI 76 Score = 32.3 bits (72), Expect(2) = 4e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135 >gb|AQK93773.1| beta tubulin2 [Zea mays] Length = 298 Score = 50.8 bits (120), Expect(2) = 4e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS RF+PRA LMDLEP T+D++ Sbjct: 46 RVNVYYNEASCGRFVPRAVLMDLEPGTMDAV 76 Score = 34.3 bits (77), Expect(2) = 4e-08 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G++L Sbjct: 115 SVLDVVRKEAENCDCLQGIDL 135 >ref|NP_001169637.1| beta tubulin 4 [Zea mays] gb|ACN34361.1| unknown [Zea mays] Length = 144 Score = 48.1 bits (113), Expect(2) = 4e-08 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 R+NVYYNEA R++PRA LMDLEP T++SI Sbjct: 48 RINVYYNEAGGGRYVPRAVLMDLEPGTMESI 78 Score = 37.0 bits (84), Expect(2) = 4e-08 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNLYPRS 181 SVLDVVRK+AEN DCL GM+L+ S Sbjct: 117 SVLDVVRKEAENCDCLQGMHLHINS 141 >gb|KMZ64223.1| Tubulin beta-1 chain [Zostera marina] Length = 461 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS RF+PRA LMDLEP T+DS+ Sbjct: 46 RVNVYYNEASGGRFVPRAVLMDLEPGTMDSV 76 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135 >ref|XP_016204804.1| tubulin beta chain [Arachis ipaensis] Length = 457 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 R+NVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 54 RINVYYNEASGGRFVPRAVLMDLEPGTMDSI 84 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 123 SVLDVVRKEAENCDCLQGFQV 143 >ref|XP_015969832.1| tubulin beta chain [Arachis duranensis] Length = 457 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 R+NVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 54 RINVYYNEASGGRFVPRAVLMDLEPGTMDSI 84 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 123 SVLDVVRKEAENCDCLQGFQV 143 >ref|XP_006410628.1| tubulin beta chain isoform X1 [Eutrema salsugineum] gb|ESQ52081.1| hypothetical protein EUTSA_v10016629mg [Eutrema salsugineum] Length = 456 Score = 51.2 bits (121), Expect(2) = 5e-08 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 R+NVYYNEAS R++PRA LMDLEP T+DSI Sbjct: 46 RINVYYNEASGGRYVPRAVLMDLEPGTMDSI 76 Score = 33.5 bits (75), Expect(2) = 5e-08 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMN 166 SVLDVVRK+AEN DCL G N Sbjct: 115 SVLDVVRKEAENCDCLQGNN 134 >ref|XP_022874431.1| tubulin beta-1 chain-like [Olea europaea var. sylvestris] Length = 447 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS RF+PRA LMDLEP T+DS+ Sbjct: 46 RVNVYYNEASGGRFVPRAVLMDLEPGTMDSV 76 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135 >ref|XP_020275972.1| tubulin beta-8 chain-like [Asparagus officinalis] Length = 447 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 46 RVNVYYNEASCGRFVPRAVLMDLEPGTMDSI 76 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135 >ref|XP_008811481.1| PREDICTED: tubulin beta-8 chain-like [Phoenix dactylifera] Length = 446 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 46 RVNVYYNEASCGRFVPRAVLMDLEPGTMDSI 76 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135 >ref|XP_022862927.1| tubulin beta-8 chain-like [Olea europaea var. sylvestris] Length = 445 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 46 RVNVYYNEASCGRFVPRAVLMDLEPGTMDSI 76 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135 >ref|XP_022001497.1| tubulin beta chain-like [Helianthus annuus] gb|OTG01978.1| putative tubulin, Beta tubulin, autoregulation binding site [Helianthus annuus] Length = 445 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 R+NVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 46 RINVYYNEASGGRFVPRAVLMDLEPGTMDSI 76 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135 >ref|XP_019167995.1| PREDICTED: tubulin beta-2 chain [Ipomoea nil] Length = 445 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 46 RVNVYYNEASCGRFVPRAVLMDLEPGTMDSI 76 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135 >ref|XP_010676480.1| PREDICTED: tubulin beta-1 chain [Beta vulgaris subsp. vulgaris] gb|KMT12097.1| hypothetical protein BVRB_5g100510 [Beta vulgaris subsp. vulgaris] Length = 445 Score = 52.4 bits (124), Expect(2) = 5e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 RVNVYYNEASRRRFMPRAALMDLEPRTIDSI 93 RVNVYYNEAS RF+PRA LMDLEP T+DSI Sbjct: 46 RVNVYYNEASCGRFVPRAVLMDLEPGTMDSI 76 Score = 32.3 bits (72), Expect(2) = 5e-08 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 107 SVLDVVRKKAENYDCL*GMNL 169 SVLDVVRK+AEN DCL G + Sbjct: 115 SVLDVVRKEAENCDCLQGFQV 135