BLASTX nr result
ID: Ophiopogon24_contig00034954
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00034954 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251805.1| E3 ubiquitin-protein ligase SINA-like 10 [As... 64 2e-09 >ref|XP_020251805.1| E3 ubiquitin-protein ligase SINA-like 10 [Asparagus officinalis] gb|ONK81452.1| uncharacterized protein A4U43_C01F29240 [Asparagus officinalis] Length = 300 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -2 Query: 357 SLHLKASATNILKWEGVYPCEVFLMVPQNFCSSSEDIALDARIQ 226 SL LKASA N+ KWEGVYP +VFL+VPQNFCSS DI L+ I+ Sbjct: 255 SLQLKASAINVRKWEGVYPSKVFLLVPQNFCSSYVDIVLNVCIK 298