BLASTX nr result
ID: Ophiopogon24_contig00034825
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00034825 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNT46772.1| hypothetical protein POPTR_003G212700v3 [Populus ... 55 5e-06 ref|XP_006386076.1| hypothetical protein POPTR_0003s21820g [Popu... 55 5e-06 >gb|PNT46772.1| hypothetical protein POPTR_003G212700v3 [Populus trichocarpa] Length = 338 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +2 Query: 2 LESDTRVLAFEAGRKGQIRVNTISAGRSPM-FLEVN 106 LESDTRVLAFEAGRK +IRVNTISAG SP+ FL ++ Sbjct: 284 LESDTRVLAFEAGRKNRIRVNTISAGNSPLNFLSIS 319 >ref|XP_006386076.1| hypothetical protein POPTR_0003s21820g [Populus trichocarpa] Length = 338 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +2 Query: 2 LESDTRVLAFEAGRKGQIRVNTISAGRSPM-FLEVN 106 LESDTRVLAFEAGRK +IRVNTISAG SP+ FL ++ Sbjct: 284 LESDTRVLAFEAGRKNRIRVNTISAGNSPLNFLSIS 319