BLASTX nr result
ID: Ophiopogon24_contig00034284
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00034284 (527 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AQK94585.1| Nuclear pore complex protein NUP205 [Zea mays] >g... 47 5e-06 gb|AQK94587.1| Nuclear pore complex protein NUP205 [Zea mays] >g... 47 9e-06 gb|AQK94598.1| Nuclear pore complex protein NUP205 [Zea mays] 47 9e-06 >gb|AQK94585.1| Nuclear pore complex protein NUP205 [Zea mays] gb|AQK94592.1| Nuclear pore complex protein NUP205 [Zea mays] gb|AQK94593.1| Nuclear pore complex protein NUP205 [Zea mays] gb|AQK94596.1| Nuclear pore complex protein NUP205 [Zea mays] gb|AQK94599.1| Nuclear pore complex protein NUP205 [Zea mays] Length = 331 Score = 47.4 bits (111), Expect(2) = 5e-06 Identities = 27/62 (43%), Positives = 37/62 (59%), Gaps = 7/62 (11%) Frame = -3 Query: 309 K*RSSSAILCISRIPIQLNGRFYRKAMRPTMLYGLVLGN*ETCP-------KISFSEMRM 151 K R ++ +LC R+P +L G+FYR A+RP MLYG E P ++S +EMRM Sbjct: 171 KKREAACVLCDPRVPHKLKGKFYRTAIRPAMLYGA-----ECWPTKRRHVQQLSVAEMRM 225 Query: 150 LR 145 LR Sbjct: 226 LR 227 Score = 30.4 bits (67), Expect(2) = 5e-06 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 343 DVVHRINAGWLKVKEFVC 290 DV HRI AGWLK +E C Sbjct: 160 DVSHRIKAGWLKKREAAC 177 >gb|AQK94587.1| Nuclear pore complex protein NUP205 [Zea mays] gb|AQK94589.1| Nuclear pore complex protein NUP205 [Zea mays] gb|AQK94591.1| Nuclear pore complex protein NUP205 [Zea mays] gb|AQK94594.1| Nuclear pore complex protein NUP205 [Zea mays] gb|AQK94595.1| Nuclear pore complex protein NUP205 [Zea mays] Length = 331 Score = 46.6 bits (109), Expect(2) = 9e-06 Identities = 27/62 (43%), Positives = 37/62 (59%), Gaps = 7/62 (11%) Frame = -3 Query: 309 K*RSSSAILCISRIPIQLNGRFYRKAMRPTMLYGLVLGN*ETCP-------KISFSEMRM 151 K R ++ +LC R+P +L G+FYR A+RP MLYG E P ++S +EMRM Sbjct: 171 KKREAACVLCDPRMPHKLKGKFYRTAIRPAMLYGA-----ECWPTKRRHVQQLSVAEMRM 225 Query: 150 LR 145 LR Sbjct: 226 LR 227 Score = 30.4 bits (67), Expect(2) = 9e-06 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 343 DVVHRINAGWLKVKEFVC 290 DV HRI AGWLK +E C Sbjct: 160 DVSHRIKAGWLKKREAAC 177 >gb|AQK94598.1| Nuclear pore complex protein NUP205 [Zea mays] Length = 309 Score = 46.6 bits (109), Expect(2) = 9e-06 Identities = 27/62 (43%), Positives = 37/62 (59%), Gaps = 7/62 (11%) Frame = -3 Query: 309 K*RSSSAILCISRIPIQLNGRFYRKAMRPTMLYGLVLGN*ETCP-------KISFSEMRM 151 K R ++ +LC R+P +L G+FYR A+RP MLYG E P ++S +EMRM Sbjct: 22 KKREAACVLCDPRMPHKLKGKFYRTAIRPAMLYGA-----ECWPTKRRHVQQLSVAEMRM 76 Query: 150 LR 145 LR Sbjct: 77 LR 78 Score = 30.4 bits (67), Expect(2) = 9e-06 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 343 DVVHRINAGWLKVKEFVC 290 DV HRI AGWLK +E C Sbjct: 11 DVSHRIKAGWLKKREAAC 28