BLASTX nr result
ID: Ophiopogon24_contig00034067
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00034067 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63167.1| Zinc knuckle family protein [Asparagus officinalis] 51 4e-08 >gb|ABD63167.1| Zinc knuckle family protein [Asparagus officinalis] Length = 583 Score = 50.8 bits (120), Expect(2) = 4e-08 Identities = 33/95 (34%), Positives = 60/95 (63%), Gaps = 9/95 (9%) Frame = -3 Query: 258 SLHDPDMCYIAIENEVMSNSDSDEPISYNELEDAFWELDREYK-LAKKFSS*K-LHDSCN 85 +LH+P++C++A E+EV+S ++S+ ++ A EL+ E+K ++K++SS K LH SC+ Sbjct: 125 ALHNPNVCFMANEDEVISEAESESFYMQCDIAMALEELNFEFKRMSKEYSSFKNLHASCD 184 Query: 84 SKLCYLTST-------LNDIIFSKIKVTFDLERLE 1 KL LT++ L D+ F ++ ++RLE Sbjct: 185 IKLEQLTTSLALKDELLGDLDFENKQLRSKIKRLE 219 Score = 34.3 bits (77), Expect(2) = 4e-08 Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -1 Query: 386 ISKNCPRRREK-KKYSNFKMKTLYVGWDEFEP 294 I+K+CP+ +EK KY K K +Y GW+E EP Sbjct: 83 IAKDCPKLKEKYMKYK--KKKAMYAGWEESEP 112