BLASTX nr result
ID: Ophiopogon24_contig00034034
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00034034 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK55105.1| uncharacterized protein A4U43_UnF7610 [Asparagus ... 89 6e-18 ref|XP_020250443.1| LOW QUALITY PROTEIN: probable anion transpor... 89 8e-18 gb|PKU68872.1| putative anion transporter 3, chloroplastic [Dend... 87 4e-17 ref|XP_022950403.1| probable anion transporter 3, chloroplastic ... 86 1e-16 ref|XP_020694699.1| probable anion transporter 2, chloroplastic ... 85 2e-16 ref|XP_008442468.1| PREDICTED: probable anion transporter 3, chl... 85 2e-16 ref|XP_004137735.1| PREDICTED: probable anion transporter 3, chl... 85 2e-16 ref|XP_023538756.1| probable anion transporter 3, chloroplastic ... 85 2e-16 gb|KQL15241.1| hypothetical protein SETIT_021709mg [Setaria ital... 84 4e-16 gb|AOZ56992.1| PHT4 [Citrullus lanatus] 84 4e-16 ref|XP_010923136.1| PREDICTED: probable anion transporter 2, chl... 84 6e-16 ref|XP_010101818.1| probable anion transporter 3, chloroplastic ... 83 8e-16 gb|OMO97496.1| hypothetical protein COLO4_14598 [Corchorus olito... 78 1e-15 gb|PKA63124.1| putative anion transporter 3, chloroplastic [Apos... 82 1e-15 ref|XP_010517089.1| PREDICTED: probable anion transporter 3, chl... 82 2e-15 ref|XP_010505416.1| PREDICTED: probable anion transporter 3, chl... 82 2e-15 ref|XP_022145491.1| probable anion transporter 3, chloroplastic ... 82 2e-15 ref|XP_022971510.1| probable anion transporter 3, chloroplastic ... 82 2e-15 ref|XP_020571138.1| probable anion transporter 3, chloroplastic ... 82 2e-15 gb|PRQ56947.1| putative phosphate-transporting ATPase [Rosa chin... 78 2e-15 >gb|ONK55105.1| uncharacterized protein A4U43_UnF7610 [Asparagus officinalis] Length = 386 Score = 88.6 bits (218), Expect = 6e-18 Identities = 43/47 (91%), Positives = 47/47 (100%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG+SLLCLKFA+TPTVAAVLMT+ALSLSSFSQAGFLLNMQ Sbjct: 272 QSIGFVGPGVSLLCLKFAQTPTVAAVLMTIALSLSSFSQAGFLLNMQ 318 >ref|XP_020250443.1| LOW QUALITY PROTEIN: probable anion transporter 3, chloroplastic [Asparagus officinalis] Length = 421 Score = 88.6 bits (218), Expect = 8e-18 Identities = 43/47 (91%), Positives = 47/47 (100%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG+SLLCLKFA+TPTVAAVLMT+ALSLSSFSQAGFLLNMQ Sbjct: 307 QSIGFVGPGVSLLCLKFAQTPTVAAVLMTIALSLSSFSQAGFLLNMQ 353 >gb|PKU68872.1| putative anion transporter 3, chloroplastic [Dendrobium catenatum] Length = 451 Score = 86.7 bits (213), Expect = 4e-17 Identities = 41/48 (85%), Positives = 48/48 (100%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQV 281 QSIGF+GPG++LLCLK+A++PTVAAVLMT+ALSLSSFSQAGFLLNMQV Sbjct: 404 QSIGFIGPGVALLCLKYAQSPTVAAVLMTIALSLSSFSQAGFLLNMQV 451 >ref|XP_022950403.1| probable anion transporter 3, chloroplastic [Cucurbita moschata] Length = 521 Score = 85.5 bits (210), Expect = 1e-16 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG++LLCLKFA TPT+AAVLMTVALSLSSFSQAG+LLNMQ Sbjct: 408 QSIGFIGPGLALLCLKFATTPTIAAVLMTVALSLSSFSQAGYLLNMQ 454 >ref|XP_020694699.1| probable anion transporter 2, chloroplastic [Dendrobium catenatum] Length = 519 Score = 85.1 bits (209), Expect = 2e-16 Identities = 40/47 (85%), Positives = 47/47 (100%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG++LLCLK+A++PTVAAVLMT+ALSLSSFSQAGFLLNMQ Sbjct: 405 QSIGFIGPGVALLCLKYAQSPTVAAVLMTIALSLSSFSQAGFLLNMQ 451 >ref|XP_008442468.1| PREDICTED: probable anion transporter 3, chloroplastic [Cucumis melo] Length = 518 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG+ LLCL FA TPTVAAVLMTVALSLSSFSQAGFLLNMQ Sbjct: 405 QSIGFIGPGLGLLCLNFATTPTVAAVLMTVALSLSSFSQAGFLLNMQ 451 >ref|XP_004137735.1| PREDICTED: probable anion transporter 3, chloroplastic [Cucumis sativus] gb|KGN58795.1| hypothetical protein Csa_3G732520 [Cucumis sativus] Length = 518 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG+ LLCL FA TPTVAAVLMTVALSLSSFSQAGFLLNMQ Sbjct: 405 QSIGFIGPGLGLLCLNFATTPTVAAVLMTVALSLSSFSQAGFLLNMQ 451 >ref|XP_023538756.1| probable anion transporter 3, chloroplastic [Cucurbita pepo subsp. pepo] Length = 521 Score = 84.7 bits (208), Expect = 2e-16 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG++LLCL FA TPT+AAVLMTVALSLSSFSQAGFLLNMQ Sbjct: 408 QSIGFIGPGLALLCLNFATTPTIAAVLMTVALSLSSFSQAGFLLNMQ 454 >gb|KQL15241.1| hypothetical protein SETIT_021709mg [Setaria italica] Length = 476 Score = 84.0 bits (206), Expect = 4e-16 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQVSFIS 269 QSIGF+GPG+SLLCL+FA+TP+VAAVLMT+ALSLSSFSQAG+ N+QV F S Sbjct: 421 QSIGFMGPGVSLLCLRFAQTPSVAAVLMTIALSLSSFSQAGYFCNIQVMFPS 472 >gb|AOZ56992.1| PHT4 [Citrullus lanatus] Length = 521 Score = 84.0 bits (206), Expect = 4e-16 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QS+GF+GPG++LLCL FA TPTVAAVLMTVALSLSSFSQAGFLLNMQ Sbjct: 408 QSMGFIGPGLALLCLNFATTPTVAAVLMTVALSLSSFSQAGFLLNMQ 454 >ref|XP_010923136.1| PREDICTED: probable anion transporter 2, chloroplastic [Elaeis guineensis] Length = 545 Score = 83.6 bits (205), Expect = 6e-16 Identities = 39/47 (82%), Positives = 46/47 (97%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG+SLLCLK+A+TPTVAAVLMT+ALSLSSFSQAG+ LN+Q Sbjct: 431 QSIGFIGPGVSLLCLKYAQTPTVAAVLMTIALSLSSFSQAGYFLNIQ 477 >ref|XP_010101818.1| probable anion transporter 3, chloroplastic [Morus notabilis] gb|EXB89955.1| putative anion transporter 3 [Morus notabilis] Length = 519 Score = 83.2 bits (204), Expect = 8e-16 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG++LLCL +A+TP VAAVLMT+ALSLSSFSQAGFLLNMQ Sbjct: 404 QSIGFIGPGVALLCLNYAKTPVVAAVLMTIALSLSSFSQAGFLLNMQ 450 >gb|OMO97496.1| hypothetical protein COLO4_14598 [Corchorus olitorius] Length = 143 Score = 78.2 bits (191), Expect = 1e-15 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG+SLLCL FA++P +AA+ +T ALSLSSFSQAGFLLNMQ Sbjct: 30 QSIGFIGPGVSLLCLNFAKSPAIAALFITAALSLSSFSQAGFLLNMQ 76 >gb|PKA63124.1| putative anion transporter 3, chloroplastic [Apostasia shenzhenica] Length = 483 Score = 82.4 bits (202), Expect = 1e-15 Identities = 39/47 (82%), Positives = 46/47 (97%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG++LLCLK+A++P+VAAVLMTVALS SSFSQAGFLLNMQ Sbjct: 422 QSIGFIGPGVALLCLKYAQSPSVAAVLMTVALSFSSFSQAGFLLNMQ 468 >ref|XP_010517089.1| PREDICTED: probable anion transporter 3, chloroplastic [Camelina sativa] Length = 509 Score = 82.4 bits (202), Expect = 2e-15 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG+SLLCL +A+TPT AAV MT+ALSLSSFSQAGFLLNMQ Sbjct: 396 QSIGFMGPGLSLLCLNYAKTPTCAAVFMTIALSLSSFSQAGFLLNMQ 442 >ref|XP_010505416.1| PREDICTED: probable anion transporter 3, chloroplastic [Camelina sativa] Length = 509 Score = 82.4 bits (202), Expect = 2e-15 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG+SLLCL +A+TPT AAV MT+ALSLSSFSQAGFLLNMQ Sbjct: 396 QSIGFMGPGLSLLCLNYAKTPTCAAVFMTIALSLSSFSQAGFLLNMQ 442 >ref|XP_022145491.1| probable anion transporter 3, chloroplastic isoform X1 [Momordica charantia] Length = 512 Score = 82.4 bits (202), Expect = 2e-15 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG++LLCL FA TPTVAAVL+TVALSLSSFSQAGFLLN+Q Sbjct: 399 QSIGFIGPGLALLCLNFATTPTVAAVLLTVALSLSSFSQAGFLLNIQ 445 >ref|XP_022971510.1| probable anion transporter 3, chloroplastic isoform X1 [Cucurbita maxima] ref|XP_022971511.1| probable anion transporter 3, chloroplastic isoform X2 [Cucurbita maxima] Length = 517 Score = 82.4 bits (202), Expect = 2e-15 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG++LLCL A TPT+AAVLMTVALSLSSFSQAGFLLNMQ Sbjct: 404 QSIGFIGPGLALLCLNLATTPTIAAVLMTVALSLSSFSQAGFLLNMQ 450 >ref|XP_020571138.1| probable anion transporter 3, chloroplastic [Phalaenopsis equestris] Length = 518 Score = 82.4 bits (202), Expect = 2e-15 Identities = 38/47 (80%), Positives = 46/47 (97%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG++LLCLK+A++PTVAAVLMT++LS SSFSQAGFLLNMQ Sbjct: 404 QSIGFIGPGVALLCLKYAQSPTVAAVLMTISLSFSSFSQAGFLLNMQ 450 >gb|PRQ56947.1| putative phosphate-transporting ATPase [Rosa chinensis] Length = 162 Score = 78.2 bits (191), Expect = 2e-15 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 424 QSIGFLGPGISLLCLKFARTPTVAAVLMTVALSLSSFSQAGFLLNMQ 284 QSIGF+GPG+SLLCL +A TPT AAVL+T AL LSSFSQAGFLLN+Q Sbjct: 102 QSIGFIGPGVSLLCLNYANTPTAAAVLLTAALCLSSFSQAGFLLNIQ 148