BLASTX nr result
ID: Ophiopogon24_contig00033064
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00033064 (1188 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW68645.1| hypothetical protein EUGRSUZ_F022471, partial [Eu... 58 4e-06 >gb|KCW68645.1| hypothetical protein EUGRSUZ_F022471, partial [Eucalyptus grandis] Length = 187 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 1 NLDFYTDVQDLFYLQNHLDQDPWSAKYMCFF 93 NLDFYTDVQDL YLQ+HLDQDP SAKY C F Sbjct: 156 NLDFYTDVQDLSYLQHHLDQDPRSAKYRCDF 186