BLASTX nr result
ID: Ophiopogon24_contig00032686
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00032686 (552 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254990.1| polygalacturonase At1g48100 [Asparagus offic... 76 1e-12 >ref|XP_020254990.1| polygalacturonase At1g48100 [Asparagus officinalis] gb|ONK78784.1| uncharacterized protein A4U43_C02F22400 [Asparagus officinalis] Length = 468 Score = 75.9 bits (185), Expect = 1e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +1 Query: 376 MRILRGFLSVLIATTLIISSFRCSNARTHFHKPKSTHKDSRRHI 507 M+IL GFLSVLIATTL++S RCSNAR HFHKPK++HKDS RHI Sbjct: 1 MKILHGFLSVLIATTLLLSGLRCSNARNHFHKPKNSHKDSGRHI 44