BLASTX nr result
ID: Ophiopogon24_contig00032451
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00032451 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264073.1| transcription factor-like protein DPB isofor... 64 1e-09 ref|XP_020264072.1| transcription factor-like protein DPB isofor... 64 1e-09 ref|XP_020264071.1| transcription factor-like protein DPB isofor... 64 2e-09 ref|XP_020264070.1| transcription factor-like protein DPB isofor... 64 2e-09 ref|XP_020264068.1| transcription factor-like protein DPB isofor... 64 2e-09 gb|PKU88066.1| hypothetical protein MA16_Dca019516 [Dendrobium c... 57 4e-07 ref|XP_020700144.1| transcription factor-like protein DPB isofor... 57 6e-07 ref|XP_020700140.1| transcription factor-like protein DPB isofor... 57 7e-07 >ref|XP_020264073.1| transcription factor-like protein DPB isoform X5 [Asparagus officinalis] ref|XP_020264074.1| transcription factor-like protein DPB isoform X5 [Asparagus officinalis] Length = 260 Score = 64.3 bits (155), Expect = 1e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -1 Query: 396 AVLKMMRCPKAGDQEQASGSSRNESLITDQSGRPLKPASFSWNSENMNLKN 244 A+LKMMRCP + EQ +S ESLI DQS RPLK + FSWNSE M++KN Sbjct: 210 AILKMMRCPHVVEPEQTYRNSSIESLINDQSSRPLKSSLFSWNSEMMSMKN 260 >ref|XP_020264072.1| transcription factor-like protein DPB isoform X4 [Asparagus officinalis] Length = 269 Score = 64.3 bits (155), Expect = 1e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -1 Query: 396 AVLKMMRCPKAGDQEQASGSSRNESLITDQSGRPLKPASFSWNSENMNLKN 244 A+LKMMRCP + EQ +S ESLI DQS RPLK + FSWNSE M++KN Sbjct: 219 AILKMMRCPHVVEPEQTYRNSSIESLINDQSSRPLKSSLFSWNSEMMSMKN 269 >ref|XP_020264071.1| transcription factor-like protein DPB isoform X3 [Asparagus officinalis] Length = 296 Score = 64.3 bits (155), Expect = 2e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -1 Query: 396 AVLKMMRCPKAGDQEQASGSSRNESLITDQSGRPLKPASFSWNSENMNLKN 244 A+LKMMRCP + EQ +S ESLI DQS RPLK + FSWNSE M++KN Sbjct: 246 AILKMMRCPHVVEPEQTYRNSSIESLINDQSSRPLKSSLFSWNSEMMSMKN 296 >ref|XP_020264070.1| transcription factor-like protein DPB isoform X2 [Asparagus officinalis] Length = 301 Score = 64.3 bits (155), Expect = 2e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -1 Query: 396 AVLKMMRCPKAGDQEQASGSSRNESLITDQSGRPLKPASFSWNSENMNLKN 244 A+LKMMRCP + EQ +S ESLI DQS RPLK + FSWNSE M++KN Sbjct: 251 AILKMMRCPHVVEPEQTYRNSSIESLINDQSSRPLKSSLFSWNSEMMSMKN 301 >ref|XP_020264068.1| transcription factor-like protein DPB isoform X1 [Asparagus officinalis] ref|XP_020264069.1| transcription factor-like protein DPB isoform X1 [Asparagus officinalis] gb|ONK69146.1| uncharacterized protein A4U43_C05F19830 [Asparagus officinalis] Length = 302 Score = 64.3 bits (155), Expect = 2e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -1 Query: 396 AVLKMMRCPKAGDQEQASGSSRNESLITDQSGRPLKPASFSWNSENMNLKN 244 A+LKMMRCP + EQ +S ESLI DQS RPLK + FSWNSE M++KN Sbjct: 252 AILKMMRCPHVVEPEQTYRNSSIESLINDQSSRPLKSSLFSWNSEMMSMKN 302 >gb|PKU88066.1| hypothetical protein MA16_Dca019516 [Dendrobium catenatum] Length = 217 Score = 57.0 bits (136), Expect = 4e-07 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -1 Query: 396 AVLKMMRCPKAGDQEQASGS-SRNESLITDQSGRPLKPASFSWNSENMNL 250 A+LKMMRCP++ + Q S S +R + I D++G+P+KPASFSWNSE++ L Sbjct: 168 AILKMMRCPQSAAKNQFSCSPARALNSIRDENGKPMKPASFSWNSESLTL 217 >ref|XP_020700144.1| transcription factor-like protein DPB isoform X2 [Dendrobium catenatum] Length = 255 Score = 57.0 bits (136), Expect = 6e-07 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -1 Query: 396 AVLKMMRCPKAGDQEQASGS-SRNESLITDQSGRPLKPASFSWNSENMNL 250 A+LKMMRCP++ + Q S S +R + I D++G+P+KPASFSWNSE++ L Sbjct: 206 AILKMMRCPQSAAKNQFSCSPARALNSIRDENGKPMKPASFSWNSESLTL 255 >ref|XP_020700140.1| transcription factor-like protein DPB isoform X1 [Dendrobium catenatum] ref|XP_020700141.1| transcription factor-like protein DPB isoform X1 [Dendrobium catenatum] ref|XP_020700142.1| transcription factor-like protein DPB isoform X1 [Dendrobium catenatum] ref|XP_020700143.1| transcription factor-like protein DPB isoform X1 [Dendrobium catenatum] Length = 303 Score = 57.0 bits (136), Expect = 7e-07 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -1 Query: 396 AVLKMMRCPKAGDQEQASGS-SRNESLITDQSGRPLKPASFSWNSENMNL 250 A+LKMMRCP++ + Q S S +R + I D++G+P+KPASFSWNSE++ L Sbjct: 254 AILKMMRCPQSAAKNQFSCSPARALNSIRDENGKPMKPASFSWNSESLTL 303