BLASTX nr result
ID: Ophiopogon24_contig00031893
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00031893 (507 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK57991.1| uncharacterized protein A4U43_C09F6540 [Asparagus... 66 2e-09 ref|XP_020246243.1| threonylcarbamoyladenosine tRNA methylthiotr... 66 2e-09 ref|XP_003539902.1| PREDICTED: threonylcarbamoyladenosine tRNA m... 65 5e-09 gb|KYP68800.1| CDK5 regulatory subunit-associated protein 1-like... 64 7e-09 ref|XP_020214606.1| threonylcarbamoyladenosine tRNA methylthiotr... 64 7e-09 gb|PIN00797.1| putative Fe-S oxidoreductase [Handroanthus impeti... 64 7e-09 gb|KFK41623.1| hypothetical protein AALP_AA2G152000 [Arabis alpina] 64 8e-09 gb|KFK41624.1| hypothetical protein AALP_AA2G152000 [Arabis alpina] 64 9e-09 emb|CBI18159.3| unnamed protein product, partial [Vitis vinifera] 64 1e-08 ref|XP_007131291.1| hypothetical protein PHAVU_011G001500g [Phas... 64 1e-08 ref|XP_017432932.1| PREDICTED: threonylcarbamoyladenosine tRNA m... 64 1e-08 ref|XP_014493810.1| threonylcarbamoyladenosine tRNA methylthiotr... 64 1e-08 ref|XP_010665090.1| PREDICTED: threonylcarbamoyladenosine tRNA m... 64 1e-08 gb|KOM51332.1| hypothetical protein LR48_Vigan08g215900 [Vigna a... 64 1e-08 ref|XP_017253873.1| PREDICTED: threonylcarbamoyladenosine tRNA m... 64 1e-08 ref|XP_021652793.1| threonylcarbamoyladenosine tRNA methylthiotr... 64 1e-08 ref|XP_007131290.1| hypothetical protein PHAVU_011G001500g [Phas... 64 1e-08 ref|XP_021652794.1| threonylcarbamoyladenosine tRNA methylthiotr... 64 1e-08 ref|XP_021895969.1| threonylcarbamoyladenosine tRNA methylthiotr... 64 1e-08 ref|XP_021600937.1| threonylcarbamoyladenosine tRNA methylthiotr... 64 1e-08 >gb|ONK57991.1| uncharacterized protein A4U43_C09F6540 [Asparagus officinalis] Length = 546 Score = 66.2 bits (160), Expect = 2e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSL+GR RAVIS+GVKE+W SSEDTGAYG+ Sbjct: 210 LGSYTVDSLLGRVRAVISEGVKEIWLSSEDTGAYGR 245 >ref|XP_020246243.1| threonylcarbamoyladenosine tRNA methylthiotransferase [Asparagus officinalis] Length = 620 Score = 66.2 bits (160), Expect = 2e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSL+GR RAVIS+GVKE+W SSEDTGAYG+ Sbjct: 210 LGSYTVDSLLGRVRAVISEGVKEIWLSSEDTGAYGR 245 >ref|XP_003539902.1| PREDICTED: threonylcarbamoyladenosine tRNA methylthiotransferase [Glycine max] gb|KHN32472.1| CDKAL1-like protein [Glycine soja] gb|KRH23747.1| hypothetical protein GLYMA_12G001400 [Glycine max] Length = 609 Score = 64.7 bits (156), Expect = 5e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYT+DSLVGR ++VIS+GVKE+W SSEDTGAYG+ Sbjct: 208 LGSYTIDSLVGRVKSVISEGVKEIWLSSEDTGAYGR 243 >gb|KYP68800.1| CDK5 regulatory subunit-associated protein 1-like 1 [Cajanus cajan] Length = 599 Score = 64.3 bits (155), Expect = 7e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSLVGR ++VIS GVKE+W SSEDTGAYG+ Sbjct: 198 LGSYTVDSLVGRVKSVISDGVKEIWLSSEDTGAYGR 233 >ref|XP_020214606.1| threonylcarbamoyladenosine tRNA methylthiotransferase [Cajanus cajan] Length = 612 Score = 64.3 bits (155), Expect = 7e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSLVGR ++VIS GVKE+W SSEDTGAYG+ Sbjct: 211 LGSYTVDSLVGRVKSVISDGVKEIWLSSEDTGAYGR 246 >gb|PIN00797.1| putative Fe-S oxidoreductase [Handroanthus impetiginosus] Length = 627 Score = 64.3 bits (155), Expect = 7e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSLVGR R+VI+ GVKE+W SSEDTGAYG+ Sbjct: 215 LGSYTVDSLVGRVRSVIADGVKEIWLSSEDTGAYGR 250 >gb|KFK41623.1| hypothetical protein AALP_AA2G152000 [Arabis alpina] Length = 369 Score = 63.9 bits (154), Expect = 8e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSLV R R VISQGVKE+W SSEDTGAYG+ Sbjct: 220 LGSYTVDSLVERVRTVISQGVKEIWLSSEDTGAYGR 255 >gb|KFK41624.1| hypothetical protein AALP_AA2G152000 [Arabis alpina] Length = 409 Score = 63.9 bits (154), Expect = 9e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSLV R R VISQGVKE+W SSEDTGAYG+ Sbjct: 220 LGSYTVDSLVERVRTVISQGVKEIWLSSEDTGAYGR 255 >emb|CBI18159.3| unnamed protein product, partial [Vitis vinifera] Length = 549 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSLVGR R VI+ GVKE+W SSEDTGAYG+ Sbjct: 141 LGSYTVDSLVGRVRTVIADGVKEIWLSSEDTGAYGR 176 >ref|XP_007131291.1| hypothetical protein PHAVU_011G001500g [Phaseolus vulgaris] gb|ESW03285.1| hypothetical protein PHAVU_011G001500g [Phaseolus vulgaris] Length = 611 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYT+DSLVGR ++VIS GVKE+W SSEDTGAYG+ Sbjct: 209 LGSYTIDSLVGRVKSVISDGVKEIWLSSEDTGAYGR 244 >ref|XP_017432932.1| PREDICTED: threonylcarbamoyladenosine tRNA methylthiotransferase [Vigna angularis] dbj|BAT91392.1| hypothetical protein VIGAN_06271500 [Vigna angularis var. angularis] Length = 613 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYT+DSLVGR ++VIS GVKE+W SSEDTGAYG+ Sbjct: 211 LGSYTIDSLVGRVKSVISDGVKEIWLSSEDTGAYGR 246 >ref|XP_014493810.1| threonylcarbamoyladenosine tRNA methylthiotransferase [Vigna radiata var. radiata] Length = 613 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYT+DSLVGR ++VIS GVKE+W SSEDTGAYG+ Sbjct: 211 LGSYTIDSLVGRVKSVISDGVKEIWLSSEDTGAYGR 246 >ref|XP_010665090.1| PREDICTED: threonylcarbamoyladenosine tRNA methylthiotransferase [Vitis vinifera] Length = 615 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSLVGR R VI+ GVKE+W SSEDTGAYG+ Sbjct: 214 LGSYTVDSLVGRVRTVIADGVKEIWLSSEDTGAYGR 249 >gb|KOM51332.1| hypothetical protein LR48_Vigan08g215900 [Vigna angularis] Length = 618 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYT+DSLVGR ++VIS GVKE+W SSEDTGAYG+ Sbjct: 216 LGSYTIDSLVGRVKSVISDGVKEIWLSSEDTGAYGR 251 >ref|XP_017253873.1| PREDICTED: threonylcarbamoyladenosine tRNA methylthiotransferase [Daucus carota subsp. sativus] gb|KZM94122.1| hypothetical protein DCAR_017367 [Daucus carota subsp. sativus] Length = 620 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSLVGR R+V++ GVKE+W SSEDTGAYG+ Sbjct: 212 LGSYTVDSLVGRVRSVVADGVKEIWLSSEDTGAYGR 247 >ref|XP_021652793.1| threonylcarbamoyladenosine tRNA methylthiotransferase isoform X1 [Hevea brasiliensis] Length = 625 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSLVGR R VI+ GVKE+W SSEDTGAYG+ Sbjct: 216 LGSYTVDSLVGRVRTVIADGVKEIWLSSEDTGAYGR 251 >ref|XP_007131290.1| hypothetical protein PHAVU_011G001500g [Phaseolus vulgaris] gb|ESW03284.1| hypothetical protein PHAVU_011G001500g [Phaseolus vulgaris] Length = 625 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYT+DSLVGR ++VIS GVKE+W SSEDTGAYG+ Sbjct: 223 LGSYTIDSLVGRVKSVISDGVKEIWLSSEDTGAYGR 258 >ref|XP_021652794.1| threonylcarbamoyladenosine tRNA methylthiotransferase isoform X2 [Hevea brasiliensis] Length = 632 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSLVGR R VI+ GVKE+W SSEDTGAYG+ Sbjct: 216 LGSYTVDSLVGRVRTVIADGVKEIWLSSEDTGAYGR 251 >ref|XP_021895969.1| threonylcarbamoyladenosine tRNA methylthiotransferase isoform X2 [Carica papaya] Length = 615 Score = 63.5 bits (153), Expect = 1e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYTVDSLVGR R VI GVKE+W SSEDTGAYG+ Sbjct: 222 LGSYTVDSLVGRVRTVIGDGVKEIWLSSEDTGAYGR 257 >ref|XP_021600937.1| threonylcarbamoyladenosine tRNA methylthiotransferase [Manihot esculenta] gb|OAY23750.1| hypothetical protein MANES_18G104200 [Manihot esculenta] Length = 617 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 505 LGSYTVDSLVGRARAVISQGVKEVWWSSEDTGAYGK 398 LGSYT+DSLVGR R VI+ GVKE+W SSEDTGAYG+ Sbjct: 218 LGSYTIDSLVGRVRTVIADGVKEIWLSSEDTGAYGR 253