BLASTX nr result
ID: Ophiopogon24_contig00031863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00031863 (577 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI44710.1| hypothetical protein CRG98_034887 [Punica granatum] 40 4e-06 >gb|PKI44710.1| hypothetical protein CRG98_034887 [Punica granatum] Length = 109 Score = 40.0 bits (92), Expect(2) = 4e-06 Identities = 18/40 (45%), Positives = 30/40 (75%) Frame = -3 Query: 236 EKFDGKSNFLL*KM*INSLLVKEGVYKAINGKEKKPSTIE 117 EKFD + +F L K+ I +L+++G++KA+ GKEKK ++E Sbjct: 9 EKFDSRKDFKLWKIKIRDVLIQKGLHKALLGKEKKLKSME 48 Score = 38.5 bits (88), Expect(2) = 4e-06 Identities = 19/39 (48%), Positives = 26/39 (66%) Frame = -1 Query: 118 NMDDVEWNEMYFHAKATIILYLSDEVLYNVMNEKTTAGL 2 +M+D EW+E A +TI L L+DEV++NV EK A L Sbjct: 46 SMEDDEWDEQDEKAVSTIHLCLADEVIFNVKEEKIAASL 84