BLASTX nr result
ID: Ophiopogon24_contig00031808
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00031808 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK62349.1| uncharacterized protein A4U43_C07F2970 [Asparagus... 74 2e-13 ref|XP_020276426.1| protein SENSITIVITY TO RED LIGHT REDUCED 1 [... 74 4e-13 >gb|ONK62349.1| uncharacterized protein A4U43_C07F2970 [Asparagus officinalis] Length = 247 Score = 73.6 bits (179), Expect = 2e-13 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -2 Query: 140 MSTPPKTLNPNPSESWTIVSHRRNRKQSKAKPNPNPNRLQFETLTL 3 MSTPPKTL NP++SWT+VSHRRNRK+ K+K NPNP+ QFETLTL Sbjct: 1 MSTPPKTLTHNPNQSWTVVSHRRNRKRPKSKSNPNPD--QFETLTL 44 >ref|XP_020276426.1| protein SENSITIVITY TO RED LIGHT REDUCED 1 [Asparagus officinalis] Length = 290 Score = 73.6 bits (179), Expect = 4e-13 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -2 Query: 140 MSTPPKTLNPNPSESWTIVSHRRNRKQSKAKPNPNPNRLQFETLTL 3 MSTPPKTL NP++SWT+VSHRRNRK+ K+K NPNP+ QFETLTL Sbjct: 1 MSTPPKTLTHNPNQSWTVVSHRRNRKRPKSKSNPNPD--QFETLTL 44