BLASTX nr result
ID: Ophiopogon24_contig00031520
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00031520 (532 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272963.1| pentatricopeptide repeat-containing protein ... 120 2e-28 ref|XP_009380612.1| PREDICTED: pentatricopeptide repeat-containi... 107 1e-23 gb|PKA53849.1| Pentatricopeptide repeat-containing protein [Apos... 103 2e-22 ref|XP_020702634.1| pentatricopeptide repeat-containing protein ... 95 2e-19 ref|XP_020588519.1| pentatricopeptide repeat-containing protein ... 92 3e-18 ref|XP_010909968.1| PREDICTED: pentatricopeptide repeat-containi... 90 1e-17 gb|OAY72362.1| Pentatricopeptide repeat-containing protein [Anan... 86 2e-16 ref|XP_009378945.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-15 ref|XP_017185268.1| PREDICTED: pentatricopeptide repeat-containi... 82 5e-15 ref|XP_008343078.1| PREDICTED: pentatricopeptide repeat-containi... 82 5e-15 ref|XP_015881313.1| PREDICTED: pentatricopeptide repeat-containi... 82 7e-15 gb|PKI62874.1| hypothetical protein CRG98_016711 [Punica granatum] 77 3e-13 ref|XP_022865565.1| pentatricopeptide repeat-containing protein ... 77 3e-13 ref|XP_022865563.1| pentatricopeptide repeat-containing protein ... 77 3e-13 emb|CBI22025.3| unnamed protein product, partial [Vitis vinifera] 77 5e-13 ref|XP_002277494.1| PREDICTED: pentatricopeptide repeat-containi... 77 5e-13 dbj|GAY34588.1| hypothetical protein CUMW_276950 [Citrus unshiu] 76 7e-13 dbj|GAY34583.1| hypothetical protein CUMW_276940 [Citrus unshiu] 76 7e-13 gb|POE71466.1| pentatricopeptide repeat-containing protein [Quer... 76 8e-13 ref|XP_023883573.1| pentatricopeptide repeat-containing protein ... 76 9e-13 >ref|XP_020272963.1| pentatricopeptide repeat-containing protein At2g41080 [Asparagus officinalis] gb|ONK62095.1| uncharacterized protein A4U43_C07F310 [Asparagus officinalis] Length = 653 Score = 120 bits (302), Expect = 2e-28 Identities = 58/77 (75%), Positives = 65/77 (84%) Frame = -3 Query: 233 LLPKSKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHA 54 L +SK+ EEFI+ CS+G+L QALQGF+P L SDPNLFSHLL+GCC KQSL Q QLHA Sbjct: 13 LSSRSKTDEEFIERCSKGYLKQALQGFLPRLRSDPNLFSHLLRGCCTPKQSLSQGQQLHA 72 Query: 53 FIIASGASSDRFTSNHL 3 FIIASGASSDRFTSNHL Sbjct: 73 FIIASGASSDRFTSNHL 89 >ref|XP_009380612.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Musa acuminata subsp. malaccensis] ref|XP_018674557.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Musa acuminata subsp. malaccensis] Length = 660 Score = 107 bits (266), Expect = 1e-23 Identities = 47/72 (65%), Positives = 60/72 (83%) Frame = -3 Query: 218 KSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIAS 39 KS +EF+ LCS+G L +AL+GF+P L SDPNLFSHLL GCC+ +QSLRQ Q+HA I+A+ Sbjct: 24 KSEQEFVHLCSKGRLREALRGFLPELWSDPNLFSHLLNGCCVPQQSLRQGQQIHALIVAA 83 Query: 38 GASSDRFTSNHL 3 GA+S RFT+NHL Sbjct: 84 GAASHRFTANHL 95 >gb|PKA53849.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 653 Score = 103 bits (257), Expect = 2e-22 Identities = 48/75 (64%), Positives = 58/75 (77%) Frame = -3 Query: 227 PKSKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFI 48 P KS EEFI LCS+G L QALQGF P + +D NLF+HLL+GCC +QSL QLH FI Sbjct: 14 PPPKSKEEFIGLCSRGFLRQALQGFFPEVFADSNLFAHLLQGCCFPQQSLSLGRQLHGFI 73 Query: 47 IASGASSDRFTSNHL 3 +A+GA+SDRFT+NHL Sbjct: 74 VAAGAASDRFTANHL 88 >ref|XP_020702634.1| pentatricopeptide repeat-containing protein At2g41080 [Dendrobium catenatum] Length = 652 Score = 95.1 bits (235), Expect = 2e-19 Identities = 47/75 (62%), Positives = 56/75 (74%) Frame = -3 Query: 227 PKSKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFI 48 PKSK EEF LCS+G L QAL GFIP + +D NLFS+LLKGC I ++SL QLH FI Sbjct: 15 PKSK--EEFTNLCSRGFLRQALYGFIPEVFADLNLFSYLLKGCSIPQESLSHGRQLHGFI 72 Query: 47 IASGASSDRFTSNHL 3 + GAS+DRFT+NHL Sbjct: 73 VTCGASADRFTANHL 87 >ref|XP_020588519.1| pentatricopeptide repeat-containing protein At2g41080 [Phalaenopsis equestris] Length = 652 Score = 91.7 bits (226), Expect = 3e-18 Identities = 43/73 (58%), Positives = 52/73 (71%) Frame = -3 Query: 221 SKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIA 42 +KS EEF LCS+G L QAL GF+P + +DPNLFS LLK C +SL QLH FI+ Sbjct: 15 TKSKEEFTHLCSRGFLRQALHGFLPEVFADPNLFSCLLKACSTSHESLSHGRQLHGFIVT 74 Query: 41 SGASSDRFTSNHL 3 GAS+DRFT+NHL Sbjct: 75 CGASADRFTANHL 87 >ref|XP_010909968.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Elaeis guineensis] Length = 670 Score = 89.7 bits (221), Expect = 1e-17 Identities = 44/73 (60%), Positives = 53/73 (72%) Frame = -3 Query: 221 SKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIA 42 SKS +EFI LCS+G L +AL GF+P L +DPNLFSH L+ CC+ QLHA II Sbjct: 36 SKSKQEFIHLCSKGSLREALLGFLPELFADPNLFSHPLQACCLLPPG--HGQQLHALIIT 93 Query: 41 SGASSDRFTSNHL 3 SGAS+DRFT+NHL Sbjct: 94 SGASNDRFTANHL 106 >gb|OAY72362.1| Pentatricopeptide repeat-containing protein [Ananas comosus] Length = 657 Score = 86.3 bits (212), Expect = 2e-16 Identities = 42/75 (56%), Positives = 53/75 (70%) Frame = -3 Query: 227 PKSKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFI 48 P S +EF++LCS G L +AL + SDPNLFSHLL+G C +LR HQLHAFI Sbjct: 23 PPSSHKQEFLRLCSNGSLREALGVLLSQQWSDPNLFSHLLRGAC----TLRHVHQLHAFI 78 Query: 47 IASGASSDRFTSNHL 3 +ASGA++DRF +NHL Sbjct: 79 LASGAAADRFAANHL 93 >ref|XP_009378945.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Pyrus x bretschneideri] Length = 668 Score = 82.8 bits (203), Expect = 4e-15 Identities = 39/69 (56%), Positives = 50/69 (72%) Frame = -3 Query: 209 EEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIASGAS 30 E+F LCS+GH+ QA +GF + SDP+LFSHLLK CI +SL A QLH+ I+ SG S Sbjct: 37 EQFTNLCSKGHIKQAFEGFKSQIWSDPSLFSHLLK-ACIPSESLSLAKQLHSLIVTSGCS 95 Query: 29 SDRFTSNHL 3 +D+F SNHL Sbjct: 96 ADKFVSNHL 104 >ref|XP_017185268.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Malus domestica] Length = 671 Score = 82.4 bits (202), Expect = 5e-15 Identities = 39/69 (56%), Positives = 50/69 (72%) Frame = -3 Query: 209 EEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIASGAS 30 E+F LCS+GH+ QA +GF + SDP+LFSHLLK CI +SL A QLH+ I+ SG S Sbjct: 40 EQFTNLCSKGHIKQAFEGFKSQIWSDPSLFSHLLK-ACIPSKSLSLAKQLHSLIVTSGCS 98 Query: 29 SDRFTSNHL 3 +D+F SNHL Sbjct: 99 ADKFVSNHL 107 >ref|XP_008343078.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Malus domestica] ref|XP_017179350.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Malus domestica] Length = 671 Score = 82.4 bits (202), Expect = 5e-15 Identities = 39/69 (56%), Positives = 50/69 (72%) Frame = -3 Query: 209 EEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIASGAS 30 E+F LCS+GH+ QA +GF + SDP+LFSHLLK CI +SL A QLH+ I+ SG S Sbjct: 40 EQFTNLCSKGHIKQAFEGFKSQIWSDPSLFSHLLK-ACIPSKSLSLAKQLHSLIVTSGCS 98 Query: 29 SDRFTSNHL 3 +D+F SNHL Sbjct: 99 ADKFVSNHL 107 >ref|XP_015881313.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Ziziphus jujuba] Length = 663 Score = 82.0 bits (201), Expect = 7e-15 Identities = 44/82 (53%), Positives = 55/82 (67%) Frame = -3 Query: 248 FYMATLLPKSKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQA 69 F T + SK+ EEF LCS+G + QA + F L SDP+LFSHLL+ CI K+SLR Sbjct: 20 FASTTSIAASKT-EEFTSLCSKGQIKQAFESFSFELWSDPSLFSHLLQ-ACIPKRSLRLG 77 Query: 68 HQLHAFIIASGASSDRFTSNHL 3 QLH+ I+ SG SSD+F SNHL Sbjct: 78 KQLHSLIVTSGCSSDKFVSNHL 99 >gb|PKI62874.1| hypothetical protein CRG98_016711 [Punica granatum] Length = 665 Score = 77.4 bits (189), Expect = 3e-13 Identities = 39/68 (57%), Positives = 46/68 (67%) Frame = -3 Query: 206 EFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIASGASS 27 EF LCS GHL +A + F + S+PNLFSHLL+ CI K SL A QLH II +G SS Sbjct: 35 EFTDLCSSGHLKEAFERFKSKIWSNPNLFSHLLQ-ACIPKNSLPLAKQLHCLIITAGCSS 93 Query: 26 DRFTSNHL 3 D+F SNHL Sbjct: 94 DKFVSNHL 101 >ref|XP_022865565.1| pentatricopeptide repeat-containing protein At2g41080 isoform X2 [Olea europaea var. sylvestris] ref|XP_022865566.1| pentatricopeptide repeat-containing protein At2g41080 isoform X2 [Olea europaea var. sylvestris] ref|XP_022865567.1| pentatricopeptide repeat-containing protein At2g41080 isoform X2 [Olea europaea var. sylvestris] Length = 665 Score = 77.4 bits (189), Expect = 3e-13 Identities = 39/73 (53%), Positives = 49/73 (67%) Frame = -3 Query: 221 SKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIA 42 S + ++FI LCS+GHL QA + ++ SDP LFSHLLK CI + S A QLH+ II Sbjct: 28 SAASQDFISLCSKGHLKQAFTIYFSHIWSDPPLFSHLLKE-CIERHSFPLAQQLHSLIIT 86 Query: 41 SGASSDRFTSNHL 3 +G S DRF SNHL Sbjct: 87 AGCSRDRFVSNHL 99 >ref|XP_022865563.1| pentatricopeptide repeat-containing protein At2g41080 isoform X1 [Olea europaea var. sylvestris] ref|XP_022865564.1| pentatricopeptide repeat-containing protein At2g41080 isoform X1 [Olea europaea var. sylvestris] Length = 666 Score = 77.4 bits (189), Expect = 3e-13 Identities = 39/73 (53%), Positives = 49/73 (67%) Frame = -3 Query: 221 SKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIA 42 S + ++FI LCS+GHL QA + ++ SDP LFSHLLK CI + S A QLH+ II Sbjct: 28 SAASQDFISLCSKGHLKQAFTIYFSHIWSDPPLFSHLLKE-CIERHSFPLAQQLHSLIIT 86 Query: 41 SGASSDRFTSNHL 3 +G S DRF SNHL Sbjct: 87 AGCSRDRFVSNHL 99 >emb|CBI22025.3| unnamed protein product, partial [Vitis vinifera] Length = 489 Score = 76.6 bits (187), Expect = 5e-13 Identities = 39/73 (53%), Positives = 49/73 (67%) Frame = -3 Query: 221 SKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIA 42 S+ EF LCS+GHL QA F ++ S+P+LFSHLL+ CI + SL QLH+ II Sbjct: 22 SELTAEFTNLCSKGHLKQAFDRFSSHIWSEPSLFSHLLQS-CISENSLSLGKQLHSLIIT 80 Query: 41 SGASSDRFTSNHL 3 SG SSD+F SNHL Sbjct: 81 SGCSSDKFISNHL 93 >ref|XP_002277494.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Vitis vinifera] Length = 657 Score = 76.6 bits (187), Expect = 5e-13 Identities = 39/73 (53%), Positives = 49/73 (67%) Frame = -3 Query: 221 SKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIA 42 S+ EF LCS+GHL QA F ++ S+P+LFSHLL+ CI + SL QLH+ II Sbjct: 22 SELTAEFTNLCSKGHLKQAFDRFSSHIWSEPSLFSHLLQS-CISENSLSLGKQLHSLIIT 80 Query: 41 SGASSDRFTSNHL 3 SG SSD+F SNHL Sbjct: 81 SGCSSDKFISNHL 93 >dbj|GAY34588.1| hypothetical protein CUMW_276950 [Citrus unshiu] Length = 586 Score = 76.3 bits (186), Expect = 7e-13 Identities = 37/71 (52%), Positives = 49/71 (69%) Frame = -3 Query: 215 SIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIASG 36 S EEFI LCS+GHL +A+ F + SDP LFSHL++ C + K+SL + QLH+ I+ SG Sbjct: 21 STEEFINLCSKGHLKEAVNRFKSEIWSDPTLFSHLIQSCTL-KKSLSCSKQLHSLIVTSG 79 Query: 35 ASSDRFTSNHL 3 SS+ F NHL Sbjct: 80 CSSNNFICNHL 90 >dbj|GAY34583.1| hypothetical protein CUMW_276940 [Citrus unshiu] Length = 1256 Score = 76.3 bits (186), Expect = 7e-13 Identities = 37/71 (52%), Positives = 49/71 (69%) Frame = -3 Query: 215 SIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLRQAHQLHAFIIASG 36 S EEFI LCS+GHL +A+ F + SDP LFSHL++ C + K+SL + QLH+ I+ SG Sbjct: 691 STEEFINLCSKGHLKEAVNRFKSEIWSDPTLFSHLIQSCTL-KKSLSCSKQLHSLIVTSG 749 Query: 35 ASSDRFTSNHL 3 SS+ F NHL Sbjct: 750 CSSNNFICNHL 760 >gb|POE71466.1| pentatricopeptide repeat-containing protein [Quercus suber] Length = 420 Score = 75.9 bits (185), Expect = 8e-13 Identities = 40/84 (47%), Positives = 54/84 (64%), Gaps = 2/84 (2%) Frame = -3 Query: 248 FYMATLLPK--SKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLR 75 ++ T+ K SK EEF LC +GH+ +A + F + SDP LFS+L+K CI ++SL Sbjct: 24 YFFCTVTSKIASKVSEEFTNLCFKGHIKEAFERFKSEIFSDPPLFSNLIKS-CIPQKSLS 82 Query: 74 QAHQLHAFIIASGASSDRFTSNHL 3 QLH+ II SG SSD+F SNHL Sbjct: 83 LGKQLHSLIITSGCSSDKFVSNHL 106 >ref|XP_023883573.1| pentatricopeptide repeat-containing protein At2g41080 [Quercus suber] Length = 670 Score = 75.9 bits (185), Expect = 9e-13 Identities = 40/84 (47%), Positives = 54/84 (64%), Gaps = 2/84 (2%) Frame = -3 Query: 248 FYMATLLPK--SKSIEEFIQLCSQGHLNQALQGFIPNLHSDPNLFSHLLKGCCIHKQSLR 75 ++ T+ K SK EEF LC +GH+ +A + F + SDP LFS+L+K CI ++SL Sbjct: 24 YFFCTVTSKIASKVSEEFTNLCFKGHIKEAFERFKSEIFSDPPLFSNLIKS-CIPQKSLS 82 Query: 74 QAHQLHAFIIASGASSDRFTSNHL 3 QLH+ II SG SSD+F SNHL Sbjct: 83 LGKQLHSLIITSGCSSDKFVSNHL 106