BLASTX nr result
ID: Ophiopogon24_contig00031177
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00031177 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254203.1| uncharacterized protein LOC109831281 [Aspara... 65 9e-10 ref|XP_020257138.1| uncharacterized protein LOC109833751 [Aspara... 61 2e-08 >ref|XP_020254203.1| uncharacterized protein LOC109831281 [Asparagus officinalis] Length = 274 Score = 65.1 bits (157), Expect = 9e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +2 Query: 2 PRLEYFVK*KGLFNSDCSWELTRALWEFEDLIEKFRREKAQR 127 PRLEYFVK KGL +S+ SWE R+LW+FEDLIEKFR+EK +R Sbjct: 233 PRLEYFVKWKGLPDSENSWEPARSLWQFEDLIEKFRQEKTKR 274 >ref|XP_020257138.1| uncharacterized protein LOC109833751 [Asparagus officinalis] Length = 236 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 2 PRLEYFVK*KGLFNSDCSWELTRALWEFEDLIEKFRREKAQR 127 PRLEYFVK K L +S+ SWE TR+LW+FE LIEKFR+EK +R Sbjct: 195 PRLEYFVKWKSLPDSENSWEPTRSLWQFEYLIEKFRQEKTKR 236