BLASTX nr result
ID: Ophiopogon24_contig00031100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00031100 (592 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27335.3| unnamed protein product, partial [Vitis vinifera] 99 7e-23 gb|AJA30440.1| auxin response factor 8 [Dimocarpus longan] 102 8e-22 gb|ESR43654.1| hypothetical protein CICLE_v10011065mg [Citrus cl... 102 1e-21 dbj|GAY33382.1| hypothetical protein CUMW_007000 [Citrus unshiu] 102 1e-21 gb|KDO57332.1| hypothetical protein CISIN_1g003544mg [Citrus sin... 102 1e-21 gb|ESR43655.1| hypothetical protein CICLE_v10011065mg [Citrus cl... 102 1e-21 dbj|GAY33380.1| hypothetical protein CUMW_007000 [Citrus unshiu] 102 1e-21 dbj|GAY33379.1| hypothetical protein CUMW_007000 [Citrus unshiu] 102 1e-21 gb|KDO57328.1| hypothetical protein CISIN_1g003544mg [Citrus sin... 102 1e-21 gb|KDO57329.1| hypothetical protein CISIN_1g003544mg [Citrus sin... 102 1e-21 dbj|GAY33381.1| hypothetical protein CUMW_007000 [Citrus unshiu] 102 1e-21 gb|KDO57331.1| hypothetical protein CISIN_1g003544mg [Citrus sin... 102 1e-21 ref|XP_015387037.1| PREDICTED: auxin response factor 8 isoform X... 102 1e-21 ref|XP_024037279.1| auxin response factor 8 isoform X2 [Citrus c... 102 1e-21 gb|KDO57330.1| hypothetical protein CISIN_1g003544mg [Citrus sin... 102 1e-21 ref|XP_006481965.1| PREDICTED: auxin response factor 8 isoform X... 102 1e-21 ref|XP_006481964.1| PREDICTED: auxin response factor 8 isoform X... 102 1e-21 ref|XP_006430416.1| auxin response factor 8 isoform X1 [Citrus c... 102 1e-21 gb|ACI46673.1| auxin response factor 8, partial [Solanum lycoper... 94 2e-21 gb|EEF36199.1| Auxin response factor, putative [Ricinus communis] 100 4e-21 >emb|CBI27335.3| unnamed protein product, partial [Vitis vinifera] Length = 163 Score = 99.4 bits (246), Expect = 7e-23 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVES 448 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSP+D+QKMGK G+ES Sbjct: 84 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKMGKQGIES 131 >gb|AJA30440.1| auxin response factor 8 [Dimocarpus longan] Length = 831 Score = 102 bits (255), Expect = 8e-22 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRGWKNPN 415 WQLVFVDRENDVLLLGDDPW+AFVNNVWYIKILSP+D+QKMG+ GVESF+ S G + N Sbjct: 762 WQLVFVDRENDVLLLGDDPWDAFVNNVWYIKILSPEDVQKMGEQGVESFNPSSGHSSRN 820 >gb|ESR43654.1| hypothetical protein CICLE_v10011065mg [Citrus clementina] Length = 523 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 451 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 504 >dbj|GAY33382.1| hypothetical protein CUMW_007000 [Citrus unshiu] Length = 694 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 622 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 675 >gb|KDO57332.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 728 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 656 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 709 >gb|ESR43655.1| hypothetical protein CICLE_v10011065mg [Citrus clementina] Length = 731 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 659 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 712 >dbj|GAY33380.1| hypothetical protein CUMW_007000 [Citrus unshiu] Length = 741 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 669 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 722 >dbj|GAY33379.1| hypothetical protein CUMW_007000 [Citrus unshiu] Length = 774 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 702 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 755 >gb|KDO57328.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 778 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 706 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 759 >gb|KDO57329.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 784 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 712 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 765 >dbj|GAY33381.1| hypothetical protein CUMW_007000 [Citrus unshiu] Length = 798 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 726 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 779 >gb|KDO57331.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 799 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 727 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 780 >ref|XP_015387037.1| PREDICTED: auxin response factor 8 isoform X3 [Citrus sinensis] Length = 808 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 736 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 789 >ref|XP_024037279.1| auxin response factor 8 isoform X2 [Citrus clementina] Length = 811 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 739 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 792 >gb|KDO57330.1| hypothetical protein CISIN_1g003544mg [Citrus sinensis] Length = 811 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 739 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 792 >ref|XP_006481965.1| PREDICTED: auxin response factor 8 isoform X2 [Citrus sinensis] Length = 811 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 739 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 792 >ref|XP_006481964.1| PREDICTED: auxin response factor 8 isoform X1 [Citrus sinensis] Length = 835 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 763 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 816 >ref|XP_006430416.1| auxin response factor 8 isoform X1 [Citrus clementina] gb|ESR43656.1| hypothetical protein CICLE_v10011065mg [Citrus clementina] Length = 835 Score = 102 bits (253), Expect = 1e-21 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS*SRG 430 WQLVFVDRENDVLLLGDDPWEAFV+NVWYIKILSP+D+QKMG+ GVESFS S G Sbjct: 763 WQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSG 816 >gb|ACI46673.1| auxin response factor 8, partial [Solanum lycopersicum] Length = 96 Score = 93.6 bits (231), Expect = 2e-21 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS 442 WQLVFVDREND+LLLGDDPWEAFVNNVWYIKILSP+D+QK+GK ES + Sbjct: 18 WQLVFVDRENDILLLGDDPWEAFVNNVWYIKILSPEDVQKLGKEEAESLN 67 >gb|EEF36199.1| Auxin response factor, putative [Ricinus communis] Length = 826 Score = 100 bits (250), Expect = 4e-21 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = -2 Query: 591 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPDDMQKMGKLGVESFS 442 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSP+D+QKMG+ GV+SFS Sbjct: 773 WQLVFVDRENDVLLLGDDPWEAFVNNVWYIKILSPEDVQKMGEQGVDSFS 822