BLASTX nr result
ID: Ophiopogon24_contig00030932
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00030932 (757 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010926588.1| PREDICTED: purine-uracil permease NCS1-like ... 89 2e-16 ref|XP_004304328.1| PREDICTED: uncharacterized permease C29B12.1... 84 1e-14 ref|XP_021770522.1| purine-uracil permease NCS1-like [Chenopodiu... 82 3e-14 ref|XP_009341474.1| PREDICTED: purine-uracil permease NCS1 [Pyru... 82 4e-14 ref|XP_021774594.1| purine-uracil permease NCS1-like [Chenopodiu... 82 6e-14 gb|OVA17920.1| Permease [Macleaya cordata] 81 7e-14 ref|XP_012082503.1| purine-uracil permease NCS1 [Jatropha curcas] 81 1e-13 ref|XP_021803660.1| purine-uracil permease NCS1, partial [Prunus... 80 1e-13 ref|XP_019249736.1| PREDICTED: purine-uracil permease NCS1 [Nico... 80 1e-13 ref|XP_010050301.1| PREDICTED: purine-uracil permease NCS1 [Euca... 80 2e-13 ref|XP_007203844.2| purine-uracil permease NCS1 [Prunus persica]... 80 2e-13 ref|XP_008241348.1| PREDICTED: purine-uracil permease NCS1 [Prun... 80 2e-13 ref|XP_022860551.1| purine-uracil permease NCS1 [Olea europaea v... 80 2e-13 ref|XP_011094562.1| purine-uracil permease NCS1 [Sesamum indicum] 80 3e-13 ref|XP_010241649.1| PREDICTED: purine-uracil permease NCS1 [Nelu... 80 3e-13 ref|XP_008366653.1| PREDICTED: purine-uracil permease NCS1-like ... 80 3e-13 ref|XP_009780325.1| PREDICTED: uncharacterized permease C29B12.1... 80 3e-13 gb|KVI08132.1| Permease for cytosine/purines, uracil, thiamine, ... 79 3e-13 gb|POO01831.1| Purine-cytosine permease [Trema orientalis] 79 3e-13 gb|OWM82453.1| hypothetical protein CDL15_Pgr002027 [Punica gran... 79 4e-13 >ref|XP_010926588.1| PREDICTED: purine-uracil permease NCS1-like [Elaeis guineensis] Length = 510 Score = 88.6 bits (218), Expect = 2e-16 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++PSSL S P+ WLATSPL+L+CF +FWLAQLA+VW+GMRGIR LEKYSAPIL Sbjct: 134 LLPSSLRSSSLSRPLPWLATSPLELACFLLFWLAQLAVVWRGMRGIRLLEKYSAPIL 190 >ref|XP_004304328.1| PREDICTED: uncharacterized permease C29B12.14c [Fragaria vesca subsp. vesca] Length = 566 Score = 83.6 bits (205), Expect = 1e-14 Identities = 37/57 (64%), Positives = 46/57 (80%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++PSS+ S F + WL TSPL+ +CF VFW+AQLA+VWKGM GIR+LEKYSAPIL Sbjct: 202 LLPSSIKSSSFSQLLPWLGTSPLEFACFIVFWVAQLAIVWKGMDGIRELEKYSAPIL 258 >ref|XP_021770522.1| purine-uracil permease NCS1-like [Chenopodium quinoa] Length = 557 Score = 82.4 bits (202), Expect = 3e-14 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P S+ S N + WL TSPL+ SCF VFWLAQL++VWKGM GIR LEKYSAPIL Sbjct: 195 LLPHSIKHSSLANVLPWLGTSPLEFSCFMVFWLAQLSIVWKGMEGIRVLEKYSAPIL 251 >ref|XP_009341474.1| PREDICTED: purine-uracil permease NCS1 [Pyrus x bretschneideri] Length = 574 Score = 82.0 bits (201), Expect = 4e-14 Identities = 35/57 (61%), Positives = 46/57 (80%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P+S+ S+ + WL TSPL+ +CF VFW+AQLA+VWKGM GIR+LEKYSAPIL Sbjct: 211 LLPNSIKQSYMSQTLPWLGTSPLEFACFIVFWVAQLAIVWKGMDGIRELEKYSAPIL 267 >ref|XP_021774594.1| purine-uracil permease NCS1-like [Chenopodium quinoa] Length = 556 Score = 81.6 bits (200), Expect = 6e-14 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P S+ S N + WL TSPL+ SCF VFWLAQL++VWKGM GIR LEKYSAPIL Sbjct: 194 LLPHSIKHSSLSNVLPWLGTSPLEFSCFIVFWLAQLSIVWKGMEGIRVLEKYSAPIL 250 >gb|OVA17920.1| Permease [Macleaya cordata] Length = 508 Score = 81.3 bits (199), Expect = 7e-14 Identities = 36/57 (63%), Positives = 42/57 (73%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P S+ S F + WL TSPL+ CF FWLAQL +VWKGM GIRQLEKYSAPIL Sbjct: 145 LLPESVKSSVFAKSLPWLGTSPLEFYCFIAFWLAQLGIVWKGMDGIRQLEKYSAPIL 201 >ref|XP_012082503.1| purine-uracil permease NCS1 [Jatropha curcas] Length = 564 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/57 (63%), Positives = 44/57 (77%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P + S + + WL TSPL+ SCF VFW+AQLA+VWKGM GIRQLEKYSAPIL Sbjct: 202 LLPKFIKQSSYSQYLPWLGTSPLEFSCFIVFWVAQLAIVWKGMEGIRQLEKYSAPIL 258 >ref|XP_021803660.1| purine-uracil permease NCS1, partial [Prunus avium] Length = 384 Score = 80.1 bits (196), Expect = 1e-13 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P+S+ S + WL TSPL+ CF VFWLAQLA+VWKGM GIR+LEKYSAP+L Sbjct: 121 LLPNSIKQSSLSQVLPWLGTSPLEFGCFIVFWLAQLAIVWKGMDGIRELEKYSAPVL 177 >ref|XP_019249736.1| PREDICTED: purine-uracil permease NCS1 [Nicotiana attenuata] gb|OIT00407.1| purine-uracil permease ncs1 [Nicotiana attenuata] Length = 579 Score = 80.5 bits (197), Expect = 1e-13 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 + P + S F P++WL TSPL+ +CF +FW+AQLA+VWKGM GIR LEKYSAPIL Sbjct: 216 LFPKVIKESSFSLPLSWLGTSPLEFTCFIIFWIAQLAIVWKGMDGIRDLEKYSAPIL 272 >ref|XP_010050301.1| PREDICTED: purine-uracil permease NCS1 [Eucalyptus grandis] Length = 567 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/57 (63%), Positives = 42/57 (73%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P SL S P WL TSPL+ +CF FWLAQL +VWKG+ GIRQLEKYSAPIL Sbjct: 204 LLPGSLKQSALSQPWPWLGTSPLEFACFIAFWLAQLTIVWKGIEGIRQLEKYSAPIL 260 >ref|XP_007203844.2| purine-uracil permease NCS1 [Prunus persica] gb|ONH96358.1| hypothetical protein PRUPE_7G123300 [Prunus persica] Length = 575 Score = 80.1 bits (196), Expect = 2e-13 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P+S+ S + WL TSPL+ CF VFWLAQLA+VWKGM GIR+LEKYSAP+L Sbjct: 212 LLPNSIKQSSLSQVLPWLGTSPLEFGCFIVFWLAQLAIVWKGMDGIRELEKYSAPVL 268 >ref|XP_008241348.1| PREDICTED: purine-uracil permease NCS1 [Prunus mume] Length = 575 Score = 80.1 bits (196), Expect = 2e-13 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P+S+ S + WL TSPL+ CF VFWLAQLA+VWKGM GIR+LEKYSAP+L Sbjct: 212 LLPNSIKQSSLSQVLPWLGTSPLEFGCFIVFWLAQLAIVWKGMDGIRELEKYSAPVL 268 >ref|XP_022860551.1| purine-uracil permease NCS1 [Olea europaea var. sylvestris] Length = 465 Score = 79.7 bits (195), Expect = 2e-13 Identities = 33/57 (57%), Positives = 45/57 (78%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P ++ S P++WL TSPL+ +CF +FWLAQL +VWKG+ GIR+LEKYSAPIL Sbjct: 194 LLPKAIKESSVSRPVSWLGTSPLEFACFIIFWLAQLGIVWKGIDGIRELEKYSAPIL 250 >ref|XP_011094562.1| purine-uracil permease NCS1 [Sesamum indicum] Length = 561 Score = 79.7 bits (195), Expect = 3e-13 Identities = 33/57 (57%), Positives = 44/57 (77%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P + S F P++WL TSPL+ +CF FW+AQL +VWKGM GI++LEKYSAPIL Sbjct: 197 LLPRIIEESTFAKPLSWLGTSPLEFACFITFWVAQLGIVWKGMDGIKELEKYSAPIL 253 >ref|XP_010241649.1| PREDICTED: purine-uracil permease NCS1 [Nelumbo nucifera] Length = 562 Score = 79.7 bits (195), Expect = 3e-13 Identities = 34/57 (59%), Positives = 44/57 (77%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++PS L + F + + WL TSPL+ SCF FWLAQ+A++WKG+ GIR LEKYSAPIL Sbjct: 204 LLPSPLKQTSFAHSLPWLGTSPLEFSCFIAFWLAQMAIIWKGIDGIRDLEKYSAPIL 260 >ref|XP_008366653.1| PREDICTED: purine-uracil permease NCS1-like [Malus domestica] Length = 574 Score = 79.7 bits (195), Expect = 3e-13 Identities = 34/57 (59%), Positives = 45/57 (78%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P+S+ S+ + WL TSP + +CF VFW+AQLA+VWKGM GIR+LEKYSAPIL Sbjct: 211 LLPNSIKQSYMSQTLPWLGTSPSEFACFIVFWVAQLAIVWKGMDGIRELEKYSAPIL 267 >ref|XP_009780325.1| PREDICTED: uncharacterized permease C29B12.14c [Nicotiana sylvestris] Length = 579 Score = 79.7 bits (195), Expect = 3e-13 Identities = 34/57 (59%), Positives = 45/57 (78%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P + S P++WL TSPL+ +CF +FW+AQLA+VWKGM GIR+LEKYSAPIL Sbjct: 216 LLPKVIKESSLSLPLSWLGTSPLEFTCFIIFWIAQLAIVWKGMDGIRELEKYSAPIL 272 >gb|KVI08132.1| Permease for cytosine/purines, uracil, thiamine, allantoin, partial [Cynara cardunculus var. scolymus] Length = 462 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/57 (63%), Positives = 45/57 (78%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P+S+ S F N I WL TSP++ +CF VFWLAQL +V KGM GIR+LEKYSAPIL Sbjct: 142 LLPNSIKTSTFSNSIPWLGTSPIEFACFMVFWLAQLLVVIKGMDGIRELEKYSAPIL 198 >gb|POO01831.1| Purine-cytosine permease [Trema orientalis] Length = 514 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = +1 Query: 586 MIPSSLTCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P + + F I WL TSPL+ +CF VFW+AQL +VWKGM GIR LEKYSAPIL Sbjct: 148 LLPKVVKTTSFAESIPWLGTSPLEFACFVVFWIAQLGIVWKGMEGIRALEKYSAPIL 204 >gb|OWM82453.1| hypothetical protein CDL15_Pgr002027 [Punica granatum] Length = 571 Score = 79.3 bits (194), Expect = 4e-13 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = +1 Query: 586 MIPSSL--TCSWFVNPITWLATSPLDLSCFAVFWLAQLALVWKGMRGIRQLEKYSAPIL 756 ++P S+ + S P+ WL TSPL+ +CF FW AQLA+VWKGM GIR+LEKYSAPIL Sbjct: 205 LLPKSIKQSSSMLTQPVPWLGTSPLEFACFLAFWTAQLAIVWKGMEGIRKLEKYSAPIL 263