BLASTX nr result
ID: Ophiopogon24_contig00030614
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00030614 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009402106.1| PREDICTED: arogenate dehydratase/prephenate ... 54 9e-06 >ref|XP_009402106.1| PREDICTED: arogenate dehydratase/prephenate dehydratase 2, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 406 Score = 54.3 bits (129), Expect = 9e-06 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -3 Query: 151 PSPLLTAEEVASRLGFHMAVEELERLFRRASVPGGHPPAEIGSPSGR 11 PSPL TAEE+ASRLG +AV LERLFR+ + G PPA+ GS SGR Sbjct: 54 PSPLGTAEEMASRLGHDIAVANLERLFRQQTAGGDRPPADGGS-SGR 99