BLASTX nr result
ID: Ophiopogon24_contig00030500
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00030500 (500 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015933373.1| ethylene-responsive transcription factor WIN... 69 3e-15 ref|XP_019078421.1| PREDICTED: ethylene-responsive transcription... 64 1e-13 ref|XP_010656426.1| PREDICTED: ethylene-responsive transcription... 64 1e-13 gb|KQL11506.1| hypothetical protein SETIT_008394mg [Setaria ital... 63 2e-13 ref|XP_004508497.1| PREDICTED: ethylene-responsive transcription... 63 2e-13 gb|OAY72031.1| Ethylene-responsive transcription factor WIN1, pa... 62 3e-13 ref|XP_016750028.1| PREDICTED: ethylene-responsive transcription... 62 3e-13 ref|XP_012448291.1| PREDICTED: ethylene-responsive transcription... 62 3e-13 ref|XP_012448292.1| PREDICTED: ethylene-responsive transcription... 62 3e-13 ref|XP_012448293.1| PREDICTED: ethylene-responsive transcription... 62 3e-13 ref|XP_011017759.1| PREDICTED: ethylene-responsive transcription... 62 4e-13 ref|XP_011017758.1| PREDICTED: ethylene-responsive transcription... 62 4e-13 ref|XP_021817724.1| ethylene-responsive transcription factor WIN... 62 4e-13 ref|XP_008242774.1| PREDICTED: ethylene-responsive transcription... 62 4e-13 ref|XP_007202491.1| ethylene-responsive transcription factor WIN... 62 4e-13 ref|XP_006600751.1| PREDICTED: ethylene-responsive transcription... 62 4e-13 gb|KHN47150.1| Ethylene-responsive transcription factor WIN1 [Gl... 62 4e-13 ref|XP_006594272.1| PREDICTED: ethylene-responsive transcription... 62 4e-13 ref|XP_020690946.1| ethylene-responsive transcription factor WIN... 62 4e-13 ref|XP_019440110.1| PREDICTED: ethylene-responsive transcription... 62 4e-13 >ref|XP_015933373.1| ethylene-responsive transcription factor WIN1 [Arachis duranensis] Length = 211 Score = 68.9 bits (167), Expect(2) = 3e-15 Identities = 33/38 (86%), Positives = 36/38 (94%), Gaps = 1/38 (2%) Frame = -1 Query: 248 TSTLVG-ALSDMVQSKKFRGVRQRHWGSWVSEIRHPLL 138 TS+L+ +LSDMVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 11 TSSLLSLSLSDMVQSKKFRGVRQRHWGSWVSEIRHPLL 48 Score = 40.0 bits (92), Expect(2) = 3e-15 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 49 KRRVWLGTFETAEEAARA 66 >ref|XP_019078421.1| PREDICTED: ethylene-responsive transcription factor WIN1 isoform X1 [Vitis vinifera] Length = 240 Score = 63.9 bits (154), Expect(2) = 1e-13 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 224 SDMVQSKKFRGVRQRHWGSWVSEIRHPLL 138 S+MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 34 SNMVQSKKFRGVRQRHWGSWVSEIRHPLL 62 Score = 40.0 bits (92), Expect(2) = 1e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 63 KRRVWLGTFETAEEAARA 80 >ref|XP_010656426.1| PREDICTED: ethylene-responsive transcription factor WIN1 isoform X2 [Vitis vinifera] ref|XP_019078422.1| PREDICTED: ethylene-responsive transcription factor WIN1 isoform X2 [Vitis vinifera] emb|CBI28202.3| unnamed protein product, partial [Vitis vinifera] Length = 239 Score = 63.9 bits (154), Expect(2) = 1e-13 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 224 SDMVQSKKFRGVRQRHWGSWVSEIRHPLL 138 S+MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 34 SNMVQSKKFRGVRQRHWGSWVSEIRHPLL 62 Score = 40.0 bits (92), Expect(2) = 1e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 63 KRRVWLGTFETAEEAARA 80 >gb|KQL11506.1| hypothetical protein SETIT_008394mg [Setaria italica] Length = 339 Score = 63.2 bits (152), Expect(2) = 2e-13 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 224 SDMVQSKKFRGVRQRHWGSWVSEIRHPLL 138 S MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 106 SGMVQSKKFRGVRQRHWGSWVSEIRHPLL 134 Score = 40.0 bits (92), Expect(2) = 2e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 135 KRRVWLGTFETAEEAARA 152 >ref|XP_004508497.1| PREDICTED: ethylene-responsive transcription factor WIN1-like [Cicer arietinum] Length = 225 Score = 62.8 bits (151), Expect(2) = 2e-13 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -1 Query: 224 SDMVQSKKFRGVRQRHWGSWVSEIRHPLL 138 ++MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 7 TNMVQSKKFRGVRQRHWGSWVSEIRHPLL 35 Score = 40.0 bits (92), Expect(2) = 2e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 36 KRRVWLGTFETAEEAARA 53 >gb|OAY72031.1| Ethylene-responsive transcription factor WIN1, partial [Ananas comosus] Length = 228 Score = 62.4 bits (150), Expect(2) = 3e-13 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 221 DMVQSKKFRGVRQRHWGSWVSEIRHPLL 138 +MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 9 NMVQSKKFRGVRQRHWGSWVSEIRHPLL 36 Score = 40.0 bits (92), Expect(2) = 3e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 37 KRRVWLGTFETAEEAARA 54 >ref|XP_016750028.1| PREDICTED: ethylene-responsive transcription factor WIN1-like isoform X1 [Gossypium hirsutum] ref|XP_017605534.1| PREDICTED: ethylene-responsive transcription factor WIN1-like isoform X1 [Gossypium arboreum] Length = 217 Score = 62.4 bits (150), Expect(2) = 3e-13 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 227 LSDMVQSKKFRGVRQRHWGSWVSEIRHPLL 138 L MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 15 LQIMVQSKKFRGVRQRHWGSWVSEIRHPLL 44 Score = 40.0 bits (92), Expect(2) = 3e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 45 KRRVWLGTFETAEEAARA 62 >ref|XP_012448291.1| PREDICTED: ethylene-responsive transcription factor WIN1-like isoform X1 [Gossypium raimondii] gb|KJB53816.1| hypothetical protein B456_009G017500 [Gossypium raimondii] Length = 217 Score = 62.4 bits (150), Expect(2) = 3e-13 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 227 LSDMVQSKKFRGVRQRHWGSWVSEIRHPLL 138 L MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 15 LQIMVQSKKFRGVRQRHWGSWVSEIRHPLL 44 Score = 40.0 bits (92), Expect(2) = 3e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 45 KRRVWLGTFETAEEAARA 62 >ref|XP_012448292.1| PREDICTED: ethylene-responsive transcription factor WIN1-like isoform X2 [Gossypium raimondii] Length = 216 Score = 62.4 bits (150), Expect(2) = 3e-13 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 227 LSDMVQSKKFRGVRQRHWGSWVSEIRHPLL 138 L MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 14 LQIMVQSKKFRGVRQRHWGSWVSEIRHPLL 43 Score = 40.0 bits (92), Expect(2) = 3e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 44 KRRVWLGTFETAEEAARA 61 >ref|XP_012448293.1| PREDICTED: ethylene-responsive transcription factor WIN1-like isoform X3 [Gossypium raimondii] gb|KJB53814.1| hypothetical protein B456_009G017500 [Gossypium raimondii] Length = 215 Score = 62.4 bits (150), Expect(2) = 3e-13 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 227 LSDMVQSKKFRGVRQRHWGSWVSEIRHPLL 138 L MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 13 LQIMVQSKKFRGVRQRHWGSWVSEIRHPLL 42 Score = 40.0 bits (92), Expect(2) = 3e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 43 KRRVWLGTFETAEEAARA 60 >ref|XP_011017759.1| PREDICTED: ethylene-responsive transcription factor WIN1-like [Populus euphratica] Length = 250 Score = 62.0 bits (149), Expect(2) = 4e-13 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 218 MVQSKKFRGVRQRHWGSWVSEIRHPLL 138 MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 45 MVQSKKFRGVRQRHWGSWVSEIRHPLL 71 Score = 40.0 bits (92), Expect(2) = 4e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 72 KRRVWLGTFETAEEAARA 89 >ref|XP_011017758.1| PREDICTED: ethylene-responsive transcription factor WIN1-like [Populus euphratica] Length = 250 Score = 62.0 bits (149), Expect(2) = 4e-13 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 218 MVQSKKFRGVRQRHWGSWVSEIRHPLL 138 MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 45 MVQSKKFRGVRQRHWGSWVSEIRHPLL 71 Score = 40.0 bits (92), Expect(2) = 4e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 72 KRRVWLGTFETAEEAARA 89 >ref|XP_021817724.1| ethylene-responsive transcription factor WIN1-like [Prunus avium] Length = 243 Score = 62.0 bits (149), Expect(2) = 4e-13 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 218 MVQSKKFRGVRQRHWGSWVSEIRHPLL 138 MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 1 MVQSKKFRGVRQRHWGSWVSEIRHPLL 27 Score = 40.0 bits (92), Expect(2) = 4e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 28 KRRVWLGTFETAEEAARA 45 >ref|XP_008242774.1| PREDICTED: ethylene-responsive transcription factor WIN1-like [Prunus mume] Length = 243 Score = 62.0 bits (149), Expect(2) = 4e-13 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 218 MVQSKKFRGVRQRHWGSWVSEIRHPLL 138 MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 1 MVQSKKFRGVRQRHWGSWVSEIRHPLL 27 Score = 40.0 bits (92), Expect(2) = 4e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 28 KRRVWLGTFETAEEAARA 45 >ref|XP_007202491.1| ethylene-responsive transcription factor WIN1 [Prunus persica] gb|ONH98330.1| hypothetical protein PRUPE_7G243600 [Prunus persica] Length = 243 Score = 62.0 bits (149), Expect(2) = 4e-13 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 218 MVQSKKFRGVRQRHWGSWVSEIRHPLL 138 MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 1 MVQSKKFRGVRQRHWGSWVSEIRHPLL 27 Score = 40.0 bits (92), Expect(2) = 4e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 28 KRRVWLGTFETAEEAARA 45 >ref|XP_006600751.1| PREDICTED: ethylene-responsive transcription factor WIN1-like [Glycine max] gb|KHN15089.1| Ethylene-responsive transcription factor WIN1 [Glycine soja] gb|KRH03696.1| hypothetical protein GLYMA_17G114500 [Glycine max] Length = 239 Score = 62.0 bits (149), Expect(2) = 4e-13 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 218 MVQSKKFRGVRQRHWGSWVSEIRHPLL 138 MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 1 MVQSKKFRGVRQRHWGSWVSEIRHPLL 27 Score = 40.0 bits (92), Expect(2) = 4e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 28 KRRVWLGTFETAEEAARA 45 >gb|KHN47150.1| Ethylene-responsive transcription factor WIN1 [Glycine soja] Length = 238 Score = 62.0 bits (149), Expect(2) = 4e-13 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 218 MVQSKKFRGVRQRHWGSWVSEIRHPLL 138 MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 1 MVQSKKFRGVRQRHWGSWVSEIRHPLL 27 Score = 40.0 bits (92), Expect(2) = 4e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 28 KRRVWLGTFETAEEAARA 45 >ref|XP_006594272.1| PREDICTED: ethylene-responsive transcription factor WIN1-like [Glycine max] gb|KRH20262.1| hypothetical protein GLYMA_13G166700 [Glycine max] Length = 238 Score = 62.0 bits (149), Expect(2) = 4e-13 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 218 MVQSKKFRGVRQRHWGSWVSEIRHPLL 138 MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 1 MVQSKKFRGVRQRHWGSWVSEIRHPLL 27 Score = 40.0 bits (92), Expect(2) = 4e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 28 KRRVWLGTFETAEEAARA 45 >ref|XP_020690946.1| ethylene-responsive transcription factor WIN1 [Dendrobium catenatum] Length = 237 Score = 62.0 bits (149), Expect(2) = 4e-13 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 218 MVQSKKFRGVRQRHWGSWVSEIRHPLL 138 MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 1 MVQSKKFRGVRQRHWGSWVSEIRHPLL 27 Score = 40.0 bits (92), Expect(2) = 4e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 28 KRRVWLGTFETAEEAARA 45 >ref|XP_019440110.1| PREDICTED: ethylene-responsive transcription factor WIN1-like [Lupinus angustifolius] gb|OIW19561.1| hypothetical protein TanjilG_07016 [Lupinus angustifolius] Length = 237 Score = 62.0 bits (149), Expect(2) = 4e-13 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 218 MVQSKKFRGVRQRHWGSWVSEIRHPLL 138 MVQSKKFRGVRQRHWGSWVSEIRHPLL Sbjct: 1 MVQSKKFRGVRQRHWGSWVSEIRHPLL 27 Score = 40.0 bits (92), Expect(2) = 4e-13 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 54 KRRVWLGTFETAEEAARA 1 KRRVWLGTFETAEEAARA Sbjct: 28 KRRVWLGTFETAEEAARA 45