BLASTX nr result
ID: Ophiopogon24_contig00030390
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00030390 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245954.1| mediator-associated protein 2 [Asparagus off... 89 4e-19 >ref|XP_020245954.1| mediator-associated protein 2 [Asparagus officinalis] gb|ONK58635.1| uncharacterized protein A4U43_C09F15080 [Asparagus officinalis] Length = 219 Score = 89.0 bits (219), Expect = 4e-19 Identities = 47/77 (61%), Positives = 61/77 (79%) Frame = -3 Query: 401 RGSEKRSSSHRSTVLRGTNGSSRDTFAFGHSTDMETPKPSKKKKYDDHRSAEGSPRGCRP 222 RGS RSSSHRSTVL+G+ G++ DTF F HST+ ETP+PS+KK+ ++HRS +GS RG RP Sbjct: 133 RGSG-RSSSHRSTVLKGSKGTA-DTFNFPHSTE-ETPQPSRKKRREEHRSGDGSSRGSRP 189 Query: 221 VSQVTDTFVVSERSHGD 171 S +TD + S+RSHGD Sbjct: 190 DSHLTDGSLASDRSHGD 206