BLASTX nr result
ID: Ophiopogon24_contig00030328
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00030328 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK64083.1| uncharacterized protein A4U43_C07F21910 [Asparagu... 64 8e-10 >gb|ONK64083.1| uncharacterized protein A4U43_C07F21910 [Asparagus officinalis] Length = 162 Score = 63.5 bits (153), Expect = 8e-10 Identities = 32/69 (46%), Positives = 41/69 (59%) Frame = +1 Query: 211 DIPEEQNQEHGHVQNSIAAXXXXXXXXXXXXYDDMIVAYALPAEVIEDSILPIYRETELS 390 D + + QEHGHVQ SIAA Y+D+IVAYAL EV++D + +RE E S Sbjct: 8 DTMDGETQEHGHVQESIAANRPRMVIRRLTTYNDVIVAYALSIEVVDDMVPSTFREAESS 67 Query: 391 SESNRWRDA 417 S S RW +A Sbjct: 68 SNSIRWMEA 76