BLASTX nr result
ID: Ophiopogon24_contig00030044
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00030044 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022969729.1| autophagy-related protein 8f [Cucurbita maxima] 152 6e-45 ref|XP_022922412.1| autophagy-related protein 8f [Cucurbita mosc... 152 6e-45 ref|XP_022154834.1| autophagy-related protein 8f [Momordica char... 152 7e-45 ref|XP_016670652.1| PREDICTED: autophagy-related protein 8f [Gos... 151 2e-44 gb|OVA16098.1| Autophagy-related protein Atg8 family [Macleaya c... 151 3e-44 ref|XP_004152407.1| PREDICTED: autophagy-related protein 8f [Cuc... 150 3e-44 gb|PON40631.1| Autophagy protein Atg8 ubiquitin-like [Parasponia... 150 5e-44 ref|XP_021768459.1| autophagy-related protein 8f [Chenopodium qu... 150 6e-44 ref|XP_019253122.1| PREDICTED: autophagy-related protein 8f [Nic... 150 6e-44 ref|XP_021853005.1| autophagy-related protein 8f [Spinacia olera... 150 6e-44 ref|XP_010695120.1| PREDICTED: autophagy-related protein 8f [Bet... 150 6e-44 ref|XP_018506252.1| PREDICTED: autophagy-related protein 8f [Pyr... 150 6e-44 ref|XP_002303509.1| autophagy 8g family protein [Populus trichoc... 150 6e-44 ref|XP_007209769.1| autophagy-related protein 8f [Prunus persica... 150 6e-44 ref|XP_019195901.1| PREDICTED: autophagy-related protein 8f-like... 150 6e-44 ref|XP_022995852.1| autophagy-related protein 8f-like isoform X1... 150 7e-44 ref|XP_022958394.1| autophagy-related protein 8f-like isoform X1... 150 7e-44 gb|OVA09800.1| Autophagy-related protein Atg8 family [Macleaya c... 150 7e-44 ref|XP_021648097.1| autophagy-related protein 8f [Hevea brasilie... 150 8e-44 ref|XP_020697853.1| autophagy-related protein 8f [Dendrobium cat... 149 1e-43 >ref|XP_022969729.1| autophagy-related protein 8f [Cucurbita maxima] Length = 120 Score = 152 bits (385), Expect = 6e-45 Identities = 71/88 (80%), Positives = 82/88 (93%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIP+IDKKKYLVPADLT+GQF V+RKRI +SPE AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPSIDKKKYLVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY++YSGENTFGF Sbjct: 91 IMSAIYEEKKDEDGFLYVTYSGENTFGF 118 >ref|XP_022922412.1| autophagy-related protein 8f [Cucurbita moschata] ref|XP_023549494.1| autophagy-related protein 8f [Cucurbita pepo subsp. pepo] Length = 120 Score = 152 bits (385), Expect = 6e-45 Identities = 71/88 (80%), Positives = 82/88 (93%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIP+IDKKKYLVPADLT+GQF V+RKRI +SPE AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPSIDKKKYLVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY++YSGENTFGF Sbjct: 91 IMSAIYEEKKDEDGFLYVTYSGENTFGF 118 >ref|XP_022154834.1| autophagy-related protein 8f [Momordica charantia] ref|XP_022154835.1| autophagy-related protein 8f [Momordica charantia] Length = 122 Score = 152 bits (385), Expect = 7e-45 Identities = 71/88 (80%), Positives = 82/88 (93%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIP+IDKKKYLVPADLT+GQF V+RKRI +SPE AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPSIDKKKYLVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY++YSGENTFGF Sbjct: 91 IMSAIYEEKKDEDGFLYVTYSGENTFGF 118 >ref|XP_016670652.1| PREDICTED: autophagy-related protein 8f [Gossypium hirsutum] ref|XP_016670653.1| PREDICTED: autophagy-related protein 8f [Gossypium hirsutum] Length = 122 Score = 151 bits (382), Expect = 2e-44 Identities = 71/87 (81%), Positives = 81/87 (93%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVPADLT+GQF V+RKRIN+S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVIRKRINLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFG 263 +MS +YEEKKDEDGFLY++YSGENTFG Sbjct: 91 IMSAIYEEKKDEDGFLYVTYSGENTFG 117 >gb|OVA16098.1| Autophagy-related protein Atg8 family [Macleaya cordata] Length = 122 Score = 151 bits (381), Expect = 3e-44 Identities = 70/88 (79%), Positives = 81/88 (92%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVPADLT+GQF V+RKRI +S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +Y+EKKDEDGFLY++YSGENTFGF Sbjct: 91 IMSTIYDEKKDEDGFLYVTYSGENTFGF 118 >ref|XP_004152407.1| PREDICTED: autophagy-related protein 8f [Cucumis sativus] ref|XP_004152408.1| PREDICTED: autophagy-related protein 8f [Cucumis sativus] ref|XP_008437098.1| PREDICTED: autophagy-related protein 8f [Cucumis melo] gb|KGN50246.1| hypothetical protein Csa_5G161950 [Cucumis sativus] Length = 118 Score = 150 bits (380), Expect = 3e-44 Identities = 70/88 (79%), Positives = 82/88 (93%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIP+IDKKKYLVPADLT+GQF V+RKRI +SPE AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPSIDKKKYLVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY++YSGENTFG+ Sbjct: 91 IMSAIYEEKKDEDGFLYVTYSGENTFGW 118 >gb|PON40631.1| Autophagy protein Atg8 ubiquitin-like [Parasponia andersonii] gb|PON93000.1| Autophagy protein Atg8 ubiquitin-like [Trema orientalis] Length = 118 Score = 150 bits (379), Expect = 5e-44 Identities = 70/88 (79%), Positives = 81/88 (92%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVPADLT+GQF V+RKRI +S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY++YSGENTFG+ Sbjct: 91 IMSAIYEEKKDEDGFLYVTYSGENTFGY 118 >ref|XP_021768459.1| autophagy-related protein 8f [Chenopodium quinoa] ref|XP_021738145.1| autophagy-related protein 8f [Chenopodium quinoa] Length = 122 Score = 150 bits (379), Expect = 6e-44 Identities = 70/88 (79%), Positives = 81/88 (92%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVPADLT+GQF V+RKRI +S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKD+DGFLY++YSGENTFGF Sbjct: 91 IMSAIYEEKKDDDGFLYVTYSGENTFGF 118 >ref|XP_019253122.1| PREDICTED: autophagy-related protein 8f [Nicotiana attenuata] ref|XP_019253123.1| PREDICTED: autophagy-related protein 8f [Nicotiana attenuata] gb|OIS98328.1| autophagy-related protein 8f [Nicotiana attenuata] Length = 122 Score = 150 bits (379), Expect = 6e-44 Identities = 69/91 (75%), Positives = 83/91 (91%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAE+SDIPNIDKKKYLVPADLT+GQF V+RKRI +S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAEKSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGFYRL 275 +MS++Y+EKKDEDGFLY++YSGENTFG+ L Sbjct: 91 IMSSIYDEKKDEDGFLYVTYSGENTFGYLNL 121 >ref|XP_021853005.1| autophagy-related protein 8f [Spinacia oleracea] ref|XP_021853007.1| autophagy-related protein 8f [Spinacia oleracea] gb|KNA22438.1| hypothetical protein SOVF_034070 [Spinacia oleracea] Length = 122 Score = 150 bits (379), Expect = 6e-44 Identities = 70/88 (79%), Positives = 81/88 (92%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVPADLT+GQF V+RKRI +S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY++YSGENTFG+ Sbjct: 91 IMSAIYEEKKDEDGFLYVTYSGENTFGY 118 >ref|XP_010695120.1| PREDICTED: autophagy-related protein 8f [Beta vulgaris subsp. vulgaris] ref|XP_010695122.1| PREDICTED: autophagy-related protein 8f [Beta vulgaris subsp. vulgaris] gb|KMS97854.1| hypothetical protein BVRB_5g122840 [Beta vulgaris subsp. vulgaris] Length = 122 Score = 150 bits (379), Expect = 6e-44 Identities = 70/88 (79%), Positives = 81/88 (92%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVPADLT+GQF V+RKRI +S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY++YSGENTFG+ Sbjct: 91 IMSAIYEEKKDEDGFLYVTYSGENTFGY 118 >ref|XP_018506252.1| PREDICTED: autophagy-related protein 8f [Pyrus x bretschneideri] ref|XP_018506253.1| PREDICTED: autophagy-related protein 8f [Pyrus x bretschneideri] Length = 122 Score = 150 bits (379), Expect = 6e-44 Identities = 70/88 (79%), Positives = 81/88 (92%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVPADLT+GQF V+RKRI +S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY++YSGENTFG+ Sbjct: 91 IMSAIYEEKKDEDGFLYVTYSGENTFGY 118 >ref|XP_002303509.1| autophagy 8g family protein [Populus trichocarpa] ref|XP_006385725.1| hypothetical protein POPTR_0003s11030g [Populus trichocarpa] Length = 122 Score = 150 bits (379), Expect = 6e-44 Identities = 70/87 (80%), Positives = 81/87 (93%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVPADLT+GQF V+RKRI +S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFG 263 +MS++YEEKKDEDGFLY++YSGENTFG Sbjct: 91 IMSSIYEEKKDEDGFLYVTYSGENTFG 117 >ref|XP_007209769.1| autophagy-related protein 8f [Prunus persica] ref|XP_008238557.1| PREDICTED: autophagy-related protein 8f [Prunus mume] ref|XP_021831948.1| autophagy-related protein 8f [Prunus avium] gb|ONI06644.1| hypothetical protein PRUPE_5G072400 [Prunus persica] gb|ONI06645.1| hypothetical protein PRUPE_5G072400 [Prunus persica] Length = 122 Score = 150 bits (379), Expect = 6e-44 Identities = 70/88 (79%), Positives = 81/88 (92%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVPADLT+GQF V+RKRI +S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY++YSGENTFG+ Sbjct: 91 IMSAIYEEKKDEDGFLYVTYSGENTFGY 118 >ref|XP_019195901.1| PREDICTED: autophagy-related protein 8f-like isoform X2 [Ipomoea nil] dbj|BAJ13302.1| autophagy 8 [Ipomoea nil] Length = 122 Score = 150 bits (379), Expect = 6e-44 Identities = 70/87 (80%), Positives = 81/87 (93%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVP+DLT+GQF V+RKRI +SPE AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPSDLTVGQFVYVIRKRIELSPEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFG 263 LMS +Y+EKKDEDGFLY++YSGENTFG Sbjct: 91 LMSAVYDEKKDEDGFLYVTYSGENTFG 117 >ref|XP_022995852.1| autophagy-related protein 8f-like isoform X1 [Cucurbita maxima] ref|XP_023534014.1| autophagy-related protein 8f-like [Cucurbita pepo subsp. pepo] Length = 118 Score = 150 bits (378), Expect = 7e-44 Identities = 70/88 (79%), Positives = 81/88 (92%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAE SDIP+IDKKKYLVPADLT+GQF V+RKRI +SPE AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAENSDIPSIDKKKYLVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY+SYSGENTFG+ Sbjct: 91 IMSAIYEEKKDEDGFLYVSYSGENTFGW 118 >ref|XP_022958394.1| autophagy-related protein 8f-like isoform X1 [Cucurbita moschata] Length = 118 Score = 150 bits (378), Expect = 7e-44 Identities = 70/88 (79%), Positives = 81/88 (92%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAE SDIP+IDKKKYLVPADLT+GQF V+RKRI +SPE AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAENSDIPSIDKKKYLVPADLTVGQFVYVIRKRIQLSPEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY+SYSGENTFG+ Sbjct: 91 IMSAIYEEKKDEDGFLYVSYSGENTFGW 118 >gb|OVA09800.1| Autophagy-related protein Atg8 family [Macleaya cordata] Length = 118 Score = 150 bits (378), Expect = 7e-44 Identities = 69/88 (78%), Positives = 81/88 (92%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVPADLT+GQF V+RKRI +S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +Y++KKDEDGFLY++YSGENTFGF Sbjct: 91 IMSTIYDDKKDEDGFLYVTYSGENTFGF 118 >ref|XP_021648097.1| autophagy-related protein 8f [Hevea brasiliensis] ref|XP_021648098.1| autophagy-related protein 8f [Hevea brasiliensis] Length = 122 Score = 150 bits (378), Expect = 8e-44 Identities = 70/87 (80%), Positives = 81/87 (93%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKAERSDIPNIDKKKYLVPADLT+GQF V+RKRI +S E AIF+F+DNVLP+TG+ Sbjct: 31 PVIVEKAERSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPSTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFG 263 +MS +YEEKKDEDGFLY++YSGENTFG Sbjct: 91 IMSAIYEEKKDEDGFLYVTYSGENTFG 117 >ref|XP_020697853.1| autophagy-related protein 8f [Dendrobium catenatum] ref|XP_020697854.1| autophagy-related protein 8f [Dendrobium catenatum] Length = 122 Score = 149 bits (377), Expect = 1e-43 Identities = 69/88 (78%), Positives = 81/88 (92%) Frame = +3 Query: 3 PVIVEKAERSDIPNIDKKKYLVPADLTLGQFACVVRKRINVSPETAIFLFIDNVLPTTGS 182 PVIVEKA+RSDIPNIDKKKYLVP+DLT+GQF V+RKRI +S E AIF+F+DNVLP TG+ Sbjct: 31 PVIVEKADRSDIPNIDKKKYLVPSDLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGA 90 Query: 183 LMSNLYEEKKDEDGFLYISYSGENTFGF 266 +MS +YEEKKDEDGFLY++YSGENTFGF Sbjct: 91 VMSTIYEEKKDEDGFLYVTYSGENTFGF 118