BLASTX nr result
ID: Ophiopogon24_contig00029721
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00029721 (597 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273559.1| pentatricopeptide repeat-containing protein ... 206 7e-58 gb|PKU87418.1| Pentatricopeptide repeat-containing protein [Dend... 152 4e-39 ref|XP_020695065.1| pentatricopeptide repeat-containing protein ... 152 4e-39 gb|PKA58554.1| Pentatricopeptide repeat-containing protein [Apos... 145 8e-37 ref|XP_020585016.1| pentatricopeptide repeat-containing protein ... 138 3e-34 ref|XP_023913469.1| pentatricopeptide repeat-containing protein ... 125 1e-29 ref|XP_019706414.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 123 7e-29 gb|PIA43834.1| hypothetical protein AQUCO_01800109v1 [Aquilegia ... 120 4e-28 gb|OWM84289.1| hypothetical protein CDL15_Pgr027058 [Punica gran... 117 5e-27 ref|XP_009411321.1| PREDICTED: pentatricopeptide repeat-containi... 117 5e-27 ref|XP_012473083.1| PREDICTED: pentatricopeptide repeat-containi... 114 6e-26 ref|XP_017627070.1| PREDICTED: pentatricopeptide repeat-containi... 114 8e-26 ref|XP_022753412.1| pentatricopeptide repeat-containing protein ... 114 8e-26 gb|PPD66766.1| hypothetical protein GOBAR_DD36359 [Gossypium bar... 114 9e-26 gb|PKI46134.1| hypothetical protein CRG98_033467 [Punica granatum] 113 2e-25 ref|XP_024195231.1| pentatricopeptide repeat-containing protein ... 112 5e-25 ref|XP_016712600.1| PREDICTED: pentatricopeptide repeat-containi... 111 1e-24 ref|XP_008223927.2| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 110 2e-24 ref|XP_020103675.1| pentatricopeptide repeat-containing protein ... 110 2e-24 gb|OAY84120.1| Pentatricopeptide repeat-containing protein, mito... 110 2e-24 >ref|XP_020273559.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Asparagus officinalis] ref|XP_020273560.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Asparagus officinalis] ref|XP_020273561.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Asparagus officinalis] gb|ONK62759.1| uncharacterized protein A4U43_C07F7840 [Asparagus officinalis] Length = 1072 Score = 206 bits (523), Expect = 7e-58 Identities = 108/150 (72%), Positives = 126/150 (84%), Gaps = 1/150 (0%) Frame = -3 Query: 451 LIKIGIAPSIKSLNLLLS-VLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K+GI PS K+LNL LS +L+SQ PNL LHLFSQI SNSIK NSKTCSLVA SLL+ + Sbjct: 20 LVKLGITPSTKTLNLFLSFLLKSQKPNLLLHLFSQISSNSIKINSKTCSLVAQSLLELHQ 79 Query: 274 FEEAQEIVSFAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFATF 95 FE A+EI S A+RF+FV KRG+W+S+IQC C EENPERAFS+L+QC++ YGI PS ATF Sbjct: 80 FE-AEEITSCAERFNFVLKRGIWNSVIQCICVKEENPERAFSILSQCIENYGIFPSSATF 138 Query: 94 RSLVLKFSSCNEMERAIEVLELMRSEKFGY 5 R LVLKFSS +MERAIEVLELMRSEKFGY Sbjct: 139 RPLVLKFSSQGKMERAIEVLELMRSEKFGY 168 >gb|PKU87418.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 1104 Score = 152 bits (384), Expect = 4e-39 Identities = 79/151 (52%), Positives = 112/151 (74%), Gaps = 1/151 (0%) Frame = -3 Query: 451 LIKIGIAPSIKSLNLLLS-VLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K ++P I+SLNL L+ +L ++ L L FSQ+ SNS++ +SKT LV H+LL+SRR Sbjct: 33 LLKSCVSPCIRSLNLFLTFLLRNRKITLLLETFSQLSSNSVQIDSKTHFLVTHALLRSRR 92 Query: 274 FEEAQEIVSFAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFATF 95 FEEAQ+ +S A+++DFV ++ +WDS+I+ C +PERA SLL++C+ GI+PS +TF Sbjct: 93 FEEAQQFISPAEKYDFVVRKSLWDSLIREVCVSGGDPERALSLLHECMRNRGISPSLSTF 152 Query: 94 RSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 R LVL FS+ MERAIEVLE+M SE+ GYP Sbjct: 153 RLLVLSFSAQGRMERAIEVLEIMTSEEIGYP 183 >ref|XP_020695065.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695066.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695067.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695068.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695069.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695070.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] Length = 1104 Score = 152 bits (384), Expect = 4e-39 Identities = 79/151 (52%), Positives = 112/151 (74%), Gaps = 1/151 (0%) Frame = -3 Query: 451 LIKIGIAPSIKSLNLLLS-VLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K ++P I+SLNL L+ +L ++ L L FSQ+ SNS++ +SKT LV H+LL+SRR Sbjct: 33 LLKSCVSPCIRSLNLFLTFLLRNRKITLLLETFSQLSSNSVQIDSKTHFLVTHALLRSRR 92 Query: 274 FEEAQEIVSFAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFATF 95 FEEAQ+ +S A+++DFV ++ +WDS+I+ C +PERA SLL++C+ GI+PS +TF Sbjct: 93 FEEAQQFISPAEKYDFVVRKSLWDSLIREVCVSGGDPERALSLLHECMRNRGISPSLSTF 152 Query: 94 RSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 R LVL FS+ MERAIEVLE+M SE+ GYP Sbjct: 153 RLLVLSFSAQGRMERAIEVLEIMTSEEIGYP 183 >gb|PKA58554.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 1068 Score = 145 bits (367), Expect = 8e-37 Identities = 78/152 (51%), Positives = 108/152 (71%), Gaps = 1/152 (0%) Frame = -3 Query: 454 ALIKIGIAPSIKSLNLLLS-VLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSR 278 +L+K + PSI+SLN+ LS +L + +L L F+QI SNSI+ +S T LV H+LL+SR Sbjct: 36 SLLKRCVRPSIRSLNIFLSFLLRKRKLSLLLETFAQISSNSIEIDSNTHFLVTHALLKSR 95 Query: 277 RFEEAQEIVSFAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFAT 98 R+EEA++ + A+++DFV ++ +WDS+I+ C G PERA +LL +CV GI+PS T Sbjct: 96 RYEEAEQFILPAEKYDFVVRKSLWDSLIRGMCVGGGKPERALNLLQECVRTQGISPSPFT 155 Query: 97 FRSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 FRSLVL SS ME AIEVLE+M SE+F YP Sbjct: 156 FRSLVLALSSQGRMEWAIEVLEIMSSERFAYP 187 >ref|XP_020585016.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Phalaenopsis equestris] ref|XP_020585017.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Phalaenopsis equestris] ref|XP_020585018.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Phalaenopsis equestris] Length = 1125 Score = 138 bits (348), Expect = 3e-34 Identities = 76/151 (50%), Positives = 103/151 (68%), Gaps = 1/151 (0%) Frame = -3 Query: 451 LIKIGIAPSIKSLNLLLS-VLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K I P ++SLNL LS +L S+ L L FSQ SNSI+ +SKT L+ +LL+SRR Sbjct: 53 LLKSCIIPCVRSLNLFLSFLLRSRKFTLLLETFSQFSSNSIQIDSKTHFLITRALLKSRR 112 Query: 274 FEEAQEIVSFAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFATF 95 FEEA + + A ++FV K+ +WDS+I+ C +PER+ SLL++C+ GI P+ TF Sbjct: 113 FEEALQFIYPADNYNFVVKKSLWDSLIRELCVAGGDPERSLSLLHECMRNRGILPALITF 172 Query: 94 RSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 RSLVL FSS ME+AIE LE+M SE+ GYP Sbjct: 173 RSLVLSFSSQGRMEKAIEALEIMTSEEVGYP 203 >ref|XP_023913469.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] ref|XP_023913470.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] ref|XP_023913471.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] ref|XP_023913472.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] ref|XP_023913474.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] ref|XP_023913475.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Quercus suber] Length = 1077 Score = 125 bits (314), Expect = 1e-29 Identities = 72/152 (47%), Positives = 97/152 (63%), Gaps = 2/152 (1%) Frame = -3 Query: 451 LIKIGIAPSIKSLN-LLLSVLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K G P++KS+N LL + ++ + +H FSQ+ SN IKPNS T S++ +LL+S + Sbjct: 20 LLKRGFTPTLKSINKFLLFLSQTHRYDSIIHFFSQLSSNQIKPNSHTHSILTWALLKSHK 79 Query: 274 FEEAQEIVSFAKRFDFV-PKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFAT 98 F+EA+ F K D + PK +WDS+IQ C + NPE+A SLL C+ GI PS T Sbjct: 80 FDEAEH---FMKTHDQIAPKTRMWDSLIQGLCTKQNNPEKALSLLQFCLRNNGIVPSSFT 136 Query: 97 FRSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 F SL+L+FSS M RAIEVLELM E YP Sbjct: 137 FFSLILRFSSEGNMGRAIEVLELMTDENVRYP 168 >ref|XP_019706414.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Elaeis guineensis] Length = 1080 Score = 123 bits (308), Expect = 7e-29 Identities = 70/148 (47%), Positives = 101/148 (68%), Gaps = 1/148 (0%) Frame = -3 Query: 448 IKIGIAPSIKSLNLLLS-VLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRRF 272 +K G+ SI++LN LS +L+++N L LFSQI SNS+ +++ SL+A +LL+S RF Sbjct: 1 MKSGLGASIQTLNPFLSFLLKTRNLRLLRPLFSQISSNSVSIDTQIHSLIAQALLKSHRF 60 Query: 271 EEAQEIVSFAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFATFR 92 +EA++ +S A+ F+P++ +W S+IQ C EE+P+RA SLL +CV G PS TFR Sbjct: 61 KEAEQFLSHAQNIAFLPRKRLWSSLIQGVCVEEEDPDRALSLLQECVRNGG--PSSNTFR 118 Query: 91 SLVLKFSSCNEMERAIEVLELMRSEKFG 8 +LV FSS MERA EVL++M EK G Sbjct: 119 ALVASFSSRGMMERAFEVLDVMTDEKNG 146 >gb|PIA43834.1| hypothetical protein AQUCO_01800109v1 [Aquilegia coerulea] Length = 1080 Score = 120 bits (302), Expect = 4e-28 Identities = 63/151 (41%), Positives = 96/151 (63%), Gaps = 1/151 (0%) Frame = -3 Query: 451 LIKIGIAPSIKSLNLLLSVL-ESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K G +P++KS N L+ L ++ N +LH FSQ+ SN I+ NS+T S++ +++ R Sbjct: 44 LLKSGFSPTLKSFNQFLTFLFKNHKFNSALHFFSQMNSNHIRGNSETRSIIVGIFIKTNR 103 Query: 274 FEEAQEIVSFAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFATF 95 F+EA++ ++ + ++G+WDS+IQ C+ ++PE+AFS+L C+ G PS TF Sbjct: 104 FQEAEQFMTQMLKDGEFFQKGIWDSLIQGICSAGKSPEKAFSVLQDCLKFRGFLPSCYTF 163 Query: 94 RSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 L+ FSS M RAIEVLELM E F YP Sbjct: 164 GLLIHSFSSLGNMSRAIEVLELMTGENFKYP 194 >gb|OWM84289.1| hypothetical protein CDL15_Pgr027058 [Punica granatum] Length = 1074 Score = 117 bits (294), Expect = 5e-27 Identities = 69/151 (45%), Positives = 92/151 (60%), Gaps = 1/151 (0%) Frame = -3 Query: 451 LIKIGIAPSIKSLNL-LLSVLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K G P+++ LN LL + ES N +H F Q+ SN+IKPNS + S +A +LL RR Sbjct: 44 LLKRGFHPTVEHLNRHLLFLSESHRFNSVIHFFPQLESNNIKPNSYSHSFLARALLNLRR 103 Query: 274 FEEAQEIVSFAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFATF 95 F+EA+ ++ A F + +WDS+IQ C + +PE+ FS+L C GI PS TF Sbjct: 104 FDEAEHLMRKAPNF---ARSSMWDSLIQGYCVHQRDPEKGFSVLLDCFGKDGILPSSYTF 160 Query: 94 RSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 SL+ FSS M RAIEVLELM EK YP Sbjct: 161 CSLIHSFSSLGMMGRAIEVLELMSDEKVKYP 191 >ref|XP_009411321.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 1083 Score = 117 bits (294), Expect = 5e-27 Identities = 70/149 (46%), Positives = 97/149 (65%), Gaps = 3/149 (2%) Frame = -3 Query: 451 LIKIGI-APSIKSLNLLLSVL--ESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQS 281 LIK G+ APS++S NLLLS L E++ P L L LFSQI SNS+ + +T SLVA +L++S Sbjct: 10 LIKAGLTAPSVRSFNLLLSFLLFEARKPRLVLCLFSQITSNSLPVDPRTHSLVARALVRS 69 Query: 280 RRFEEAQEIVSFAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFA 101 RRF +A +S A DF +R + +S+I+ C E NP+ A SLL +CV G+ PS Sbjct: 70 RRFHDAGRFISRAP-LDFGFRRSLVESLIRRLCVAERNPDGALSLLQECVRNRGVFPSLG 128 Query: 100 TFRSLVLKFSSCNEMERAIEVLELMRSEK 14 +FRS+V F S ++RA+EVLE +K Sbjct: 129 SFRSVVAAFCSLGRLDRAVEVLEAAADKK 157 >ref|XP_012473083.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] ref|XP_012473084.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] ref|XP_012473085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] ref|XP_012473086.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] ref|XP_012473087.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] ref|XP_012473089.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] gb|KJB22015.1| hypothetical protein B456_004G025400 [Gossypium raimondii] Length = 1072 Score = 114 bits (286), Expect = 6e-26 Identities = 71/153 (46%), Positives = 93/153 (60%), Gaps = 3/153 (1%) Frame = -3 Query: 451 LIKIGIAPSIKSLN-LLLSVLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K G P++KS+N LLL + S+ N +HLFSQ+ SN I PNS+T S++ SLL+ + Sbjct: 24 LLKRGFTPTLKSINQLLLFLSRSRRFNAVIHLFSQLDSNKINPNSQTHSILICSLLKLHK 83 Query: 274 FEEAQEIVS--FAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFA 101 FEEA+ +VS +K DF PK WDS+IQ NPE+ LL C+ G PS Sbjct: 84 FEEAEHLVSTQMSKYPDF-PKTRFWDSLIQGFGVIRNNPEKGLLLLKDCLRDSGTLPSSF 142 Query: 100 TFRSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 TF SL+ F S M+RAIEVLELM + YP Sbjct: 143 TFCSLIHSFVSQGNMDRAIEVLELMTGDNVRYP 175 >ref|XP_017627070.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium arboreum] ref|XP_017627071.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium arboreum] ref|XP_017627072.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium arboreum] Length = 1074 Score = 114 bits (285), Expect = 8e-26 Identities = 71/153 (46%), Positives = 93/153 (60%), Gaps = 3/153 (1%) Frame = -3 Query: 451 LIKIGIAPSIKSLN-LLLSVLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K G P++KS+N LLL + S+ N +HLFSQ+ SN I PNS+T S++ SLL+ + Sbjct: 24 LLKRGFTPTLKSINQLLLFLSHSRRFNAVIHLFSQLDSNKINPNSQTHSILICSLLKLHK 83 Query: 274 FEEAQEIVS--FAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFA 101 FEEA+ +VS +K DF PK WDS+IQ NPE+ LL C+ G PS Sbjct: 84 FEEAEHLVSTQMSKCPDF-PKTRFWDSLIQGFGVIRNNPEKGLLLLKDCLSDSGTLPSSF 142 Query: 100 TFRSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 TF SL+ F S M+RAIEVLELM + YP Sbjct: 143 TFCSLIHGFVSQGNMDRAIEVLELMTGDNVRYP 175 >ref|XP_022753412.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial isoform X1 [Durio zibethinus] Length = 1090 Score = 114 bits (285), Expect = 8e-26 Identities = 67/152 (44%), Positives = 93/152 (61%), Gaps = 2/152 (1%) Frame = -3 Query: 451 LIKIGIAPSIKSLNLLLSVLE-SQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 LIK G P++KS+N LLS L S+ N +HLFSQ+ SN IK N +T S++ +LL+ + Sbjct: 30 LIKRGFTPTLKSINQLLSFLSYSRKFNSVVHLFSQLESNKIKANFQTHSILIWALLRLYK 89 Query: 274 FEEAQEIVSFA-KRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFAT 98 FEEA+ +++ +F K WDS+IQ C + NP++ LL C+ G PS +T Sbjct: 90 FEEAEHLMNTRLSKFSNFSKTRFWDSLIQGFCVIQNNPQKGLFLLKNCLMNCGTLPSSST 149 Query: 97 FRSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 F SL+ F S M+RAIEVLELM +K YP Sbjct: 150 FCSLIHSFISQGNMDRAIEVLELMTGDKIRYP 181 >gb|PPD66766.1| hypothetical protein GOBAR_DD36359 [Gossypium barbadense] Length = 629 Score = 114 bits (284), Expect = 9e-26 Identities = 71/153 (46%), Positives = 93/153 (60%), Gaps = 3/153 (1%) Frame = -3 Query: 451 LIKIGIAPSIKSLN-LLLSVLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K G P++KS+N LLL + S+ N +HLFSQ+ SN I PNS+T S++ SLL+ + Sbjct: 24 LLKRGFTPTVKSINQLLLFLSHSRRFNAVIHLFSQLDSNKINPNSQTHSILICSLLKLHK 83 Query: 274 FEEAQEIVS--FAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFA 101 FEEA+ +VS +K DF PK WDS+IQ NPE+ LL C+ G PS Sbjct: 84 FEEAEHLVSTQMSKCPDF-PKTRFWDSLIQGFGVIRNNPEKGLLLLKDCLRDSGTLPSSF 142 Query: 100 TFRSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 TF SL+ F S M+RAIEVLELM + YP Sbjct: 143 TFCSLIHGFVSQGNMDRAIEVLELMTGDNVRYP 175 >gb|PKI46134.1| hypothetical protein CRG98_033467 [Punica granatum] Length = 1063 Score = 113 bits (283), Expect = 2e-25 Identities = 67/147 (45%), Positives = 90/147 (61%), Gaps = 1/147 (0%) Frame = -3 Query: 451 LIKIGIAPSIKSLNL-LLSVLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K G P+++ LN LL + ES N +H F Q+ SN+IKPNS + S +A +LL RR Sbjct: 44 LLKRGFHPTVEHLNRHLLFLSESHRFNSVIHFFPQLESNNIKPNSYSHSFLARALLNLRR 103 Query: 274 FEEAQEIVSFAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFATF 95 F+EA+ ++ A F + +WDS+IQ C + +PE+ FS+L C GI PS TF Sbjct: 104 FDEAEHLMRKAPNF---ARSSMWDSLIQGYCVHQRDPEKGFSVLLDCFGKDGILPSSYTF 160 Query: 94 RSLVLKFSSCNEMERAIEVLELMRSEK 14 SL+ FSS M RAIEVLELM EK Sbjct: 161 CSLIHSFSSLGMMGRAIEVLELMSDEK 187 >ref|XP_024195231.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Rosa chinensis] ref|XP_024195232.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Rosa chinensis] ref|XP_024195233.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Rosa chinensis] ref|XP_024195234.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Rosa chinensis] ref|XP_024195235.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Rosa chinensis] ref|XP_024195236.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Rosa chinensis] ref|XP_024195237.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Rosa chinensis] gb|PRQ37198.1| putative tetratricopeptide-like helical domain-containing protein [Rosa chinensis] Length = 1095 Score = 112 bits (279), Expect = 5e-25 Identities = 60/153 (39%), Positives = 95/153 (62%), Gaps = 3/153 (1%) Frame = -3 Query: 451 LIKIGIAPSIKSL-NLLLSVLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K G P++ S+ LL + + N +H FSQ+ SN IK NS+T S++ +LL+ + Sbjct: 37 LLKRGFTPTLNSIIQFLLFLSHTHRFNTVIHFFSQMESNQIKGNSQTRSILTWALLKLHK 96 Query: 274 FEEAQEIV--SFAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFA 101 +E+A+ + AK +F P+ +WD++IQ C +++P++A +L C+ YG PS Sbjct: 97 YEDAEHFMRTQMAKASNF-PRNRMWDTLIQGLCINQKDPDKALLVLRDCLRKYGTFPSSF 155 Query: 100 TFRSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 TF SL+ +FSS +M +AIEV+ELM EK YP Sbjct: 156 TFCSLIYRFSSMGDMSKAIEVVELMTDEKINYP 188 >ref|XP_016712600.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium hirsutum] ref|XP_016712601.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium hirsutum] ref|XP_016712602.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium hirsutum] ref|XP_016712603.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium hirsutum] Length = 1074 Score = 111 bits (277), Expect = 1e-24 Identities = 70/153 (45%), Positives = 92/153 (60%), Gaps = 3/153 (1%) Frame = -3 Query: 451 LIKIGIAPSIKSLN-LLLSVLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K G P++KS+N LLL + S+ N +HLFSQ+ S I PNS+T S++ SLL+ + Sbjct: 24 LLKRGFTPTLKSINQLLLFLSHSRRFNAVIHLFSQLDSYKINPNSQTHSILICSLLKLHK 83 Query: 274 FEEAQEIVS--FAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFA 101 FEEA+ +VS +K DF PK WDS+IQ NPE+ LL C+ G PS Sbjct: 84 FEEAEHLVSTQMSKCPDF-PKTRFWDSLIQGFGVIRNNPEKGLLLLKDCLSDSGTLPSSF 142 Query: 100 TFRSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 TF SL+ F S M+RAIEVLELM + YP Sbjct: 143 TFCSLIHGFVSQGNMDRAIEVLELMTGDNVRYP 175 >ref|XP_008223927.2| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Prunus mume] Length = 1079 Score = 110 bits (275), Expect = 2e-24 Identities = 63/153 (41%), Positives = 96/153 (62%), Gaps = 3/153 (1%) Frame = -3 Query: 451 LIKIGIAPSIKSL-NLLLSVLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 L+K G P++KS+ LL + +++ N +H FSQ+ SN IK NS+T S++ +LL+ + Sbjct: 42 LLKSGFTPTLKSIIQFLLFLSQTRRFNTVIHFFSQMDSNRIKGNSQTRSILTWALLKLHK 101 Query: 274 FEEAQEIVS--FAKRFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFA 101 +EEA+ ++ A+ F R +WDS+IQ C ++PE+A +L C+ YGI PS Sbjct: 102 YEEAEHFMTTQMAETSKFQSNR-IWDSLIQGLCINRKDPEKALLVLRDCLINYGIFPSSF 160 Query: 100 TFRSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 TF SL+ +FS +M +AIEVLELM +K YP Sbjct: 161 TFFSLINRFSYQGDMSKAIEVLELMTDDKVRYP 193 >ref|XP_020103675.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Ananas comosus] ref|XP_020103676.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Ananas comosus] Length = 1099 Score = 110 bits (275), Expect = 2e-24 Identities = 63/152 (41%), Positives = 91/152 (59%), Gaps = 2/152 (1%) Frame = -3 Query: 451 LIKIGIAPSIKSLNLLLS-VLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 LIK G APS ++L LS +L S+ P+L L LF + S I+ + +T +LVA +LL+S R Sbjct: 38 LIKSGSAPSAQTLAPFLSFLLRSRKPHLLLRLFPNLSSEPIRSDPRTLTLVARALLESHR 97 Query: 274 FEEAQEIVSFAK-RFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFAT 98 +EA +S + R F G+WDS+I+ C + +P +A +L +CV GI PS T Sbjct: 98 LDEAARFISRDEDRLGFASDIGLWDSLIRRVCVFDADPRKALTLFQECVRYRGIVPSLIT 157 Query: 97 FRSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 FR LV F S +ME A+EV ++M K G+P Sbjct: 158 FRVLVSSFCSQGDMESAVEVFDVMLVRKKGFP 189 >gb|OAY84120.1| Pentatricopeptide repeat-containing protein, mitochondrial [Ananas comosus] Length = 942 Score = 110 bits (274), Expect = 2e-24 Identities = 63/152 (41%), Positives = 91/152 (59%), Gaps = 2/152 (1%) Frame = -3 Query: 451 LIKIGIAPSIKSLNLLLS-VLESQNPNLSLHLFSQILSNSIKPNSKTCSLVAHSLLQSRR 275 LIK G APS ++L LS +L S+ P+L L LF + S I+ + +T +LVA +LL+S R Sbjct: 38 LIKSGSAPSAQTLAPFLSFLLRSRKPHLLLRLFPHLSSEPIRSDPRTLTLVARALLESHR 97 Query: 274 FEEAQEIVSFAK-RFDFVPKRGVWDSIIQCACAGEENPERAFSLLNQCVDVYGITPSFAT 98 +EA +S A+ R F G+WDS+I+ C + +P +A +L +CV GI PS T Sbjct: 98 LDEAARFISRAEHRLSFASDIGLWDSLIRRVCVFDADPRKALTLFQECVRYRGIVPSLIT 157 Query: 97 FRSLVLKFSSCNEMERAIEVLELMRSEKFGYP 2 FR LV F S +ME A+EV ++M K +P Sbjct: 158 FRVLVSSFCSQGDMESAVEVFDVMLVRKKEFP 189