BLASTX nr result
ID: Ophiopogon24_contig00029629
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00029629 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272888.1| kinesin-like protein KIN-12E isoform X1 [Asp... 36 6e-06 gb|ONK63044.1| uncharacterized protein A4U43_C07F10830, partial ... 36 6e-06 >ref|XP_020272888.1| kinesin-like protein KIN-12E isoform X1 [Asparagus officinalis] ref|XP_020272889.1| kinesin-like protein KIN-12E isoform X1 [Asparagus officinalis] ref|XP_020272891.1| kinesin-like protein KIN-12E isoform X1 [Asparagus officinalis] Length = 2125 Score = 35.8 bits (81), Expect(3) = 6e-06 Identities = 23/46 (50%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -3 Query: 233 KTHFNSIQDPSQHSIPS-QIDLGFYKGARSTPKSIQIITERSRSRV 99 ++ +SI DPSQ S QID KGA TPKS+QI R SRV Sbjct: 34 RSPLSSIHDPSQISANGLQIDPFSVKGAGLTPKSVQIAAARCGSRV 79 Score = 35.4 bits (80), Expect(3) = 6e-06 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 102 GSDGNGSMRERGCLSRVLKGAQN 34 GS GS +ERGCLSRVLKGAQ+ Sbjct: 76 GSRVLGSTKERGCLSRVLKGAQD 98 Score = 25.4 bits (54), Expect(3) = 6e-06 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -1 Query: 319 RHQEKLVPVPNPRNPMRTSFETPIPFPTPR-PIS 221 R + P+ + N +R + PIPFPTPR P+S Sbjct: 6 RSSSRPKPLESNENELRNPGD-PIPFPTPRSPLS 38 >gb|ONK63044.1| uncharacterized protein A4U43_C07F10830, partial [Asparagus officinalis] Length = 2052 Score = 35.8 bits (81), Expect(3) = 6e-06 Identities = 23/46 (50%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -3 Query: 233 KTHFNSIQDPSQHSIPS-QIDLGFYKGARSTPKSIQIITERSRSRV 99 ++ +SI DPSQ S QID KGA TPKS+QI R SRV Sbjct: 34 RSPLSSIHDPSQISANGLQIDPFSVKGAGLTPKSVQIAAARCGSRV 79 Score = 35.4 bits (80), Expect(3) = 6e-06 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 102 GSDGNGSMRERGCLSRVLKGAQN 34 GS GS +ERGCLSRVLKGAQ+ Sbjct: 76 GSRVLGSTKERGCLSRVLKGAQD 98 Score = 25.4 bits (54), Expect(3) = 6e-06 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -1 Query: 319 RHQEKLVPVPNPRNPMRTSFETPIPFPTPR-PIS 221 R + P+ + N +R + PIPFPTPR P+S Sbjct: 6 RSSSRPKPLESNENELRNPGD-PIPFPTPRSPLS 38