BLASTX nr result
ID: Ophiopogon24_contig00029564
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00029564 (731 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD94118.1| putative endosomal protein, partial [Arabidopsis... 54 8e-06 >dbj|BAD94118.1| putative endosomal protein, partial [Arabidopsis thaliana] Length = 124 Score = 54.3 bits (129), Expect = 8e-06 Identities = 29/63 (46%), Positives = 35/63 (55%), Gaps = 4/63 (6%) Frame = +3 Query: 3 VALTYFQLAAEDHEWWWR*V----SHSPFLQAYAPMHHYTQKHTPF*FYSYVSLIRYASC 170 VALTYFQLAAEDHEWWWR S F+ AY +++Y + F Y +C Sbjct: 35 VALTYFQLAAEDHEWWWRSFLCGGSTGLFIYAYC-LYYYYARSDMSGFMQTSFFFGYMAC 93 Query: 171 ICY 179 ICY Sbjct: 94 ICY 96