BLASTX nr result
ID: Ophiopogon24_contig00029554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00029554 (399 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276616.1| uncharacterized protein LOC109850939 [Aspara... 60 1e-07 >ref|XP_020276616.1| uncharacterized protein LOC109850939 [Asparagus officinalis] ref|XP_020276621.1| uncharacterized protein LOC109850939 [Asparagus officinalis] Length = 618 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/46 (60%), Positives = 34/46 (73%), Gaps = 2/46 (4%) Frame = +2 Query: 266 MAEYQLSIGSQDHTLLGVHDHNLLGLDDHNFVGGQE--LANADYSL 397 M ++QL IG+QDH LLGV DHNLLG++DH V GQE N DY+L Sbjct: 1 MGDHQLPIGAQDHNLLGVPDHNLLGVEDHGLVTGQEHNFVNTDYTL 46