BLASTX nr result
ID: Ophiopogon24_contig00029552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00029552 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010939205.1| PREDICTED: SNAP25 homologous protein SNAP33 ... 71 9e-12 ref|XP_008777761.1| PREDICTED: SNAP25 homologous protein SNAP33-... 58 3e-07 >ref|XP_010939205.1| PREDICTED: SNAP25 homologous protein SNAP33 [Elaeis guineensis] Length = 303 Score = 70.9 bits (172), Expect = 9e-12 Identities = 38/87 (43%), Positives = 49/87 (56%) Frame = +2 Query: 152 ISEMATTRTPPSKDYKPRSGNPGLXXXXXXXXXXXXXLNSKPSRASSAPVPSKGDHKISQ 331 +S+++T RTP SK K RS NPG LN K +RASSAPV S+ + K SQ Sbjct: 1 MSKISTMRTPMSKASKQRSANPGFLGSNPFDSDSELDLNHKTARASSAPVVSEANKKSSQ 60 Query: 332 PGYGENEGRGAXXXXXXXXFAAGRNRY 412 GY E+EGRG F++ RN+Y Sbjct: 61 SGYSEDEGRGTSSSSSYSGFSSARNKY 87 >ref|XP_008777761.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Phoenix dactylifera] Length = 301 Score = 58.2 bits (139), Expect = 3e-07 Identities = 34/87 (39%), Positives = 47/87 (54%) Frame = +2 Query: 152 ISEMATTRTPPSKDYKPRSGNPGLXXXXXXXXXXXXXLNSKPSRASSAPVPSKGDHKISQ 331 +S+++ RTP SK K RS +PG LN K +RASSAP S+ + + SQ Sbjct: 1 MSKISAMRTPVSKASKQRSADPGFSGSNPFDSDSESNLNHKNARASSAPAISRANKESSQ 60 Query: 332 PGYGENEGRGAXXXXXXXXFAAGRNRY 412 GY E+EGRG F++ RN+Y Sbjct: 61 FGYSEDEGRGT--SSSYSGFSSARNKY 85